Produits biochimiques et réactifs

<p>Uhmk1 antibody was raised in rabbit using the C terminal of Uhmk1 as the immunogen</p>

<p>The PLCG2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets PLCG2, an enzyme involved in various cellular processes. This antibody has been widely used to study the role of PLCG2 in signal transduction pathways and its association with diseases.</p>

<p>Collagen Type XI Alpha 2 antibody was raised using the N terminal of COL11A2 corresponding to a region with amino acids TADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSG</p>

<p>Rabbit polyclonal ERP29 antibody (HRP)</p>

<p>E.coli-derived, 15.5 kDa Recombinant Human IL-2</p>

<p>Rabbit polyclonal ST3GAL5 antibody</p>

<p>Rat monoclonal OX40 Ligand antibody (PE)</p>

<p>ADCY2 antibody was raised in rabbit using the middle region of ADCY2 as the immunogen</p>

<p>Sulphadoxine Conjugate for use in immunoassays</p>

<p>Alkaline phosphatase antibody was raised in mouse using human placental alkaline phosphatase as the immunogen.</p>

<p>The AQP1 antibody is a growth factor that belongs to the class of monoclonal antibodies. It has been shown to inhibit the multidrug resistance protein and enhance the expression of E-cadherin, a cell adhesion molecule. This antibody specifically targets AQP1, which is a water channel protein involved in various physiological processes. The AQP1 antibody has been extensively used in life sciences research to study its role in different cellular pathways. Additionally, it has been found to have cytotoxic effects on cancer cells and can interfere with nuclear signaling pathways. Its potential as a therapeutic agent is being explored in various fields, including oncology and immunology.</p>

<p>Region of LIX protein corresponding to amino acids TELRCVCLTV TPKINPKLIA NLEVIPAGPQ CPTVEVIAKL KNQKEVCLDP EAPVIKKIIQ KILGSDKKKA.</p>

<p>C-myc antibody (HRP) was raised in goat using a synthetic peptide representing amino acid residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>The FGFR3 antibody is a histidine-rich interferon family kinase inhibitor that is widely used in the Life Sciences field. It possesses strong inhibitory properties, particularly against diacylglycerol, making it an effective tool for studying various cellular processes. This monoclonal antibody specifically targets and binds to the glycoprotein FGFR3, blocking its activity and preventing the activation of downstream signaling pathways. By inhibiting FGFR3, this antibody can interfere with epidermal growth factor-mediated cell proliferation and survival. Additionally, it has cytotoxic effects on cancer cells that overexpress FGFR3, making it a potential therapeutic option for certain types of cancers. The FGFR3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with versatile tools for their experiments.</p>

<p>Antagonist of oxytocin receptor</p>

<p>Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP</p>

<p>MEN1 antibody was raised in Rabbit using Human MEN1 as the immunogen</p>

<p>CMV antibody was raised in mouse using a 66 kDa antigen appearing in the cytoplasm and nucleus. as the immunogen.</p>

<p>Purified Rabbit polyclonal DQX1 antibody</p>

<p>BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV</p>

<p>MRFAP1 antibody was raised in Rabbit using Human MRFAP1 as the immunogen</p>

<p>The ATF2 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically binds to ATF2, a transcription factor that plays a crucial role in various cellular processes. This monoclonal antibody is widely used in research and diagnostic applications to study the function and regulation of ATF2.</p>

<p>Purified Polyclonal RPL30 antibody</p>

<p>Mouse monoclonal M-Ficolin antibody</p>

<p>Mouse monoclonal MTRF1L antibody</p>

<p>RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMF1 antibody, catalog no. 70R-9583</p>

<p>The INA antibody is a monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets androgen receptor (AR) signaling, which plays a crucial role in various biological processes. The INA antibody can be used in assays to detect and quantify AR levels, as well as to study the effects of AR modulation on downstream signaling pathways.</p>

<p>CPA6 antibody was raised in rabbit using the middle region of CPA6 as the immunogen</p>

<p>Mouse monoclonal XPNPEP3 antibody</p>

<p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>

<p>Rabbit polyclonal PHKG2 antibody</p>

<p>Affinity purified Rabbit polyclonal DPRP1 antibody</p>

<p>Affinity purified Rabbit polyclonal beta A4 Crystallin antibody</p>

<p>The Hexokinase 3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This antibody specifically targets and binds to the glycine microsphere, which is involved in the regulation of phosphatase activity and growth factor signaling.</p>

<p>Purified recombinant IL6 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SUV39H2 antibody, catalog no. 70R-4560</p>

<p>Rabbit polyclonal E2F2 antibody</p>

<p>Purified recombinant TXNL4B protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WARS antibody, catalog no. 70R-2448</p>

<p>C11ORF67 antibody was raised using the middle region of C11Orf67 corresponding to a region with amino acids SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST</p>

<p>Rabbit anti-mouse IgM was raised in rabbit using murine IgM mu heavy chain as the immunogen.</p>

<p>Mouse anti Rat IgM secondary antibody (HRP)</p>

<p>TRAF4 antibody was raised in rabbit using the middle region of TRAF4 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>Tgfb1 antibody was raised in rabbit using the middle region of TGFB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC14 antibody, catalog no. 70R-7047</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG1 antibody, catalog no. 70R-6612</p>

<p>Affinity purified Rabbit polyclonal PIK3R4 antibody</p>

<p>ADAMTS4 antibody was raised using the N terminal of ADAMTS4 corresponding to a region with amino acids GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL</p>

<p>NEK2 antibody was raised in Rabbit using Human NEK2 as the immunogen</p>

<p>Rabbit polyclonal APBA2 antibody</p>

<p>ARNTL antibody was raised in Mouse using a purified recombinant fragment of human ARNTL expressed in E. coli as the immunogen.</p>

<p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

<p>FZD9 antibody was raised in Rabbit using Human FZD9 as the immunogen</p>

<p>PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV</p>

<p>Rat monoclonal CD115 antibody (biotin)</p>

<p>INPP5A antibody was raised in Rabbit using Human INPP5A as the immunogen</p>

<p>CTDSP2 antibody was raised in Rabbit using Human CTDSP2 as the immunogen</p>

<p>MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV</p>

<p>Rabbit polyclonal Goat Serum Albumin antibody (HRP)</p>

<p>DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF</p>

<p>Rabbit Polyclonal p62Dok antibody (Tyr362)</p>

<p>Rabbit polyclonal ACOT8 antibody</p>

<p>Purified Polyclonal NOLC1 antibody</p>

<p>The Tau antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's. The antibody has been extensively tested using techniques like electrophoresis and has shown high specificity and affinity for its target. It recognizes specific epitopes on the Tau protein, inhibiting its aggregation and preventing the formation of neurofibrillary tangles. Additionally, this antibody has been used in research to study the effects of various compounds like erythropoietin and sorafenib on Tau pathology. Its unique properties make it an essential tool for understanding the mechanisms underlying neurodegeneration and developing potential therapeutic interventions.</p>

<p>Purified recombinant Human RUVBL1 protein</p>

<p>FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIFAP3 antibody, catalog no. 70R-3247</p>

<p>Mouse monoclonal HVEM antibody (PE)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>KIF2A antibody was raised using the C terminal of KIF2A corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED</p>

<p>EBV protein is a multifunctional protein that plays a crucial role in various biological processes. It acts as an epidermal growth factor, promoting cell proliferation and differentiation. Additionally, it functions as a chemokine and endothelial growth factor, facilitating the migration and angiogenesis of endothelial cells.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>B4galt6 antibody was raised in rabbit using the C terminal of B4galt6 as the immunogen</p>

<p>The LTA4H antibody is a monoclonal antibody that specifically targets the antigen LTA4H. It is colloidal in nature and belongs to the class of monoclonal antibodies. This antibody has been widely used in various applications in the field of Life Sciences, including immunoassays and research studies. The LTA4H antibody has shown high specificity and sensitivity in detecting LTA4H, making it a valuable tool for researchers studying this antigen. It can be used in experiments involving carbon quantum dots, steroids, collagen, ketamine, and other related compounds. Additionally, this antibody can also be utilized for the detection of autoantibodies or as a therapeutic agent targeting specific diseases. The LTA4H antibody is supplied in a buffered solution to ensure stability and optimal performance.</p>

<p>PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL</p>

<p>DTL antibody was raised in Rabbit using Human DTL as the immunogen</p>

<p>Sheep polyclonal Norsertraline antibody</p>

<p>Purified recombinant IRF5 protein (His tag)</p>

<p>CEACAM19 antibody was raised using the middle region of CEACAM19 corresponding to a region with amino acids MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNA</p>

<p>CDK3 antibody was raised in Rabbit using Human CDK3 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>MYO16 antibody was raised in Rabbit using Human MYO16 as the immunogen</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>ZNF566 antibody was raised in rabbit using the middle region of ZNF566 as the immunogen</p>

<p>Gp100 (25-33), human is a fragment of the human melanoma antigen. It is a 9-amino acid (AA) epitope restricted by H-2Db and recognized by the T cells. Gp100 (25-33) induces CD8+ T cells capable of recognizing B16 melanoma specifically.</p>

<p>Region of WISP1 protein corresponding to amino acids TALSPAPTTM DFTPAPLEDT SSRPQFCKWP CECPPSPPRC PLGVSLITDG CECCKMCAQQ LGDNCTEAAI CDPHRGLYCD YSGDRPRYAI GVCAQVVGVG CVLDGVRYNN GQSFQPNCKY NCTCIDGAVG CTPLCLRVRP PRLWCPHPRR VSIPGHCCEQ WVCEDDAKRP RKTAPRDTGA FDAVGEVEAW HRNCIAYTSP WSPCSTSCGL GVSTRISNVN AQCWPEQESR LCNLRPCDVD IHTLIKAGKK CLAVYQPEAS MNFTLAGCIS TRSYQPKYCG VCMDNRCCIP YKSKTIDVSF QCPDGLGFSR QVLWINACFC NLSCRNPNDI FADLESYPDF SEIAN.</p>

<p>Tnk1 antibody was raised in Mouse using a purified recombinant fragment of Tnk1(aa451-560) expressed in E. coli as the immunogen.</p>

<p>NAB2 antibody was raised in Rabbit using Human NAB2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AMDHD1 antibody, catalog no. 70R-4162</p>

<p>Srpx antibody was raised in rabbit using the C terminal of Srpx as the immunogen</p>

<p>ZNF608 antibody was raised in rabbit using the middle region of ZNF608 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG12 antibody, catalog no. 70R-9259</p>

<p>DNAJC2 antibody was raised in Rabbit using Human DNAJC2 as the immunogen</p>

<p>Mouse monoclonal CCR3 antibody (PE)</p>

<p>CRK antibody was raised in Rabbit using Human CRK as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EFHC1 antibody, catalog no. 70R-9246</p>

<p>CD45RC antibody was raised in rat using an exon C-depentent epitope of the CD45 glycoprotein as the immunogen.</p>

<p>Purified recombinant RASSF1A protein</p>