Produits biochimiques et réactifs

<p>Rabbit polyclonal RPL27 antibody</p>

<p>C9orf64 antibody was raised in rabbit using the C terminal of C9orf64 as the immunogen</p>

<p>Recombinant Human ELP4 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC14 antibody, catalog no. 70R-8048</p>

<p>IFNGR2 antibody was raised in mouse using human interferon gamma receptor chain 2 as the immunogen.</p>

<p>PLAGL1 antibody was raised in rabbit using the N terminal of PLAGL1 as the immunogen</p>

<p>ACVRL1 antibody was raised using the N terminal of ACVRL1 corresponding to a region with amino acids SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXCT1 antibody, catalog no. 70R-5319</p>

<p>Rabbit polyclonal RAB26 antibody</p>

<p>Human IgG antibody was raised in mouse using human serum IgG as the immunogen.</p>

<p>Protein S antibody is a highly specialized product in the field of Life Sciences. It is used for various applications such as particle chemiluminescence and polymerase chain reactions. This antibody is specifically designed to neutralize autoantibodies against human protein S, which plays a crucial role in the coagulation process. By targeting these autoantibodies, Protein S antibody enables accurate immunoassays and antigen-antibody reactions in research and diagnostic settings.</p>

<p>Phenobarbital N Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal VOPP1 antibody (FITC)</p>

<p>Rabbit polyclonal SLC39A7 antibody</p>

<p>Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>Smad1, gst tagged human is a Research tool that is a ligand of the TGF-β receptor. It is involved in the development and functioning of various organs, such as bone, muscle, heart, kidney and lungs. Smad1 is also an activator of Ligand at the cell surface. It can be used as a research tool for studying protein interactions and pharmacology.</p>

<p>GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ</p>

<p>Non-Sterile Sodium Heparin Human Plasma</p>

<p>Mouse monoclonal SH2D2A antibody</p>

<p>Purified recombinant TNFAIP8 protein (His tag)</p>

<p>KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ</p>

<p>ZNF266 antibody was raised in rabbit using the N terminal of ZNF266 as the immunogen</p>

<p>BAD antibody was raised in rabbit using the C terminal of BAD as the immunogen</p>

<p>SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF</p>

<p>ANKRD11 antibody was raised in mouse using recombinant Human Ankyrin Repeat Domain 11 (Ankrd11)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This drug is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. It works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITLN2 antibody, catalog no. 70R-4496</p>

<p>Rabbit polyclonal PLANH1 antibody (FITC)</p>

<p>JAKMIP2 antibody was raised in rabbit using the C terminal of JAKMIP2 as the immunogen</p>

<p>GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL</p>

<p>Esrra antibody was raised in rabbit using the C terminal of Esrra as the immunogen</p>

<p>Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL</p>

<p>Purified recombinant Human MSRB3 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385B antibody, catalog no. 70R-8995</p>

<p>Purified Rabbit polyclonal OR1S1/1S2 antibody</p>

<p>MAP4K5 antibody was raised in Rabbit using Human MAP4K5 as the immunogen</p>

<p>4-Nitrophenyl-AOZ Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT6 antibody, catalog no. 70R-7465</p>

<p>Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN</p>

<p>The ALDOA antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of serine protease ALDOA, which plays a crucial role in various biological processes. This antibody is capable of binding to ALDOA dimers and inhibiting their function.</p>

<p>Rabbit polyclonal FAKD2 antibody</p>

<p>The Cystatin B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Cystatin B, a fatty acid-binding protein involved in various cellular processes. This antibody is particularly useful for studying the role of Cystatin B in interferon-activated pathways, endocytic uptake mechanisms, and low-density lipoprotein metabolism.</p>

<p>The N-Cadherin antibody is a cationic derivative that plays a crucial role in various biological processes. It acts as a receptor for epidermal growth factor and is involved in cell adhesion and signaling pathways. This polyclonal antibody is specifically designed to target N-Cadherin, neutralizing its activity and allowing for further investigation into its function.</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>The SPAG16 antibody is a highly valuable protein in the field of Life Sciences. It is a polypeptide reagent that is widely used as a detection reagent for various biomarkers. Polyclonal Antibodies generated against SPAG16 have proven to be effective in inhibiting the activity of this protein, making them an essential tool in research and diagnostics. These antibodies can be used to detect and quantify SPAG16 levels in biological samples, making them valuable biomarker detection reagents. Additionally, they have been utilized to identify autoantibodies targeting SPAG16, which can provide important insights into autoimmune diseases and serve as potential therapeutic targets. The SPAG16 antibody plays a crucial role in advancing our understanding of cellular processes and has the potential to contribute significantly to the development of new medicines and treatments.</p>

<p>The NSE antibody is a powerful tool in the field of life sciences. It is an interferon that exhibits cytotoxic properties and specifically targets transthyretin. This antibody binds to transthyretin, a protein that plays a crucial role in various biological processes. By binding to transthyretin, the NSE antibody can modulate its activity and function.</p>

<p>NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53INP2 antibody, catalog no. 70R-9644</p>

<p>C2ORF33 antibody was raised using the C terminal Of C2Orf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW</p>

<p>The NK1R antibody is a highly effective medicament that belongs to the group of polyclonal antibodies. It is widely used in the field of Life Sciences for its exceptional properties. This antibody specifically targets and binds to the Neurokinin 1 receptor (NK1R), which plays a crucial role in various physiological processes. The binding of the NK1R antibody to its target leads to a cascade of events, including the inhibition of lectins and calmodulin, as well as the activation of growth factors and collagen synthesis.</p>

<p>The EGFR antibody is a protein-based product that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR), an important growth factor involved in various cellular processes. This antibody has been extensively used in research and diagnostic applications.</p>

<p>DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DEKIEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSE</p>

<p>RXRA antibody was raised using the C terminal of RXRA corresponding to a region with amino acids MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ</p>

<p>TBC1D13 antibody was raised using the middle region of TBC1D13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS</p>

<p>B3GNT7 antibody was raised using the N terminal of B3GNT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR</p>

<p>Rabbit polyclonal TGF beta Receptor 3 antibody</p>

<p>Myoglobin antibody was raised in Rabbit using Human MB as the immunogen</p>

<p>Affinity purified Rabbit polyclonal IPMK antibody</p>

<p>Rabbit anti-rat IgG (H+L) (Fab'2) (HRP) was raised in rabbit using rat IgG, whole molecule as the immunogen.</p>

<p>Purified Polyclonal ELF4 antibody</p>

<p>The BIN2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the fatty acid-binding protein known as BIN2. This protein plays a crucial role in various biological processes, including epidermal growth and the regulation of alpha-fetoprotein.</p>

<p>Pex2 antibody was raised in rabbit using the C terminal of Pex2 as the immunogen</p>

<p>Purified recombinant Human EEF1D protein</p>

<p>The RFP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the RFP protein, also known as red fluorescent protein. This antibody can be used for various applications, including immunofluorescence staining, Western blotting, and flow cytometry.</p>

<p>19-131 amino acids: MLPVNSPMNK GDTEVMKCIV EVISDTLSKP SPMPVSQECF ETLRGDERIL SILRHQNLLK ELQDLALQGA KERAHQQKKH SGFEDELSEV LENQSSQAEL KEAVEEPSSK DVME</p>

<p>The GHRHR antibody is a powerful inhibitor that targets the TRPV4 channel, making it an effective medicament for various applications. This antibody specifically inhibits the activity of serine proteases, reducing the risk of excitotoxicity and protecting cells from damage. It has been widely used in the field of life sciences as a diagnostic agent to detect specific proteins such as myoglobin, fibrinogen, and MIP-1β. Additionally, this antibody has shown promising results in pluripotent stem cell research by regulating lactate production and promoting cell differentiation. With its multifaceted properties and diverse applications, the GHRHR antibody is a valuable tool for researchers and medical professionals alike.</p>

<p>HOXC9 antibody was raised in mouse using recombinant Homeo Box C9</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPLX2 antibody, catalog no. 70R-4500</p>

<p>Affinity purified Rabbit polyclonal Collagen III alpha1 antibody</p>

<p>nNOS antibody was raised in rabbit using residues 19-31 [PRKGPPLPNGDTEC] of NOS as the immunogen.</p>

<p>Zaleplon Conjugate for use in immunoassays</p>

<p>DDX3Y antibody was raised in Rabbit using Human DDX3Y as the immunogen</p>

<p>Rabbit polyclonal TBX2 antibody</p>

<p>Rabbit polyclonal NPM antibody (Thr199)</p>

<p>Rat monoclonal CD8 antibody (FITC); IgG2a kappa</p>

<p>Region of GMF beta protein corresponding to amino acids SESLVVCDVA EDLVEKLRKF RFRKETNNAA IIMKIDKDKR LVVLDEELEG ISPDELKDEL PERQPRFIVY SYKYQHDDGR VSYPLCFIFS SPVGCKPEQQ MMYAGSKNKL VQTAELTKVF EIRNTEDLTE EWLREKLGFF H.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This active compound exhibits oxidative metabolites and undergoes hydrolysis by esterases, reduction by glutathione reductase, and oxidation by cytochrome p450 enzymes. It specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Goat RBC antibody (Texas Red) was raised in rabbit using goat erythrocytes as the immunogen.</p>

<p>1-360 amino acids: MGSSHHHHHH SSGLVPRGSH MAAAAAAGAG PEMVRGQVFD VGPRYTNLSY IGEGAYGMVC SAYDNVNKVR VAIKKISPFE HQTYCQRTLR EIKILLRFRH ENIIGINDII RAPTIEQMKD VYIVQDLMET DLYKLLKTQH LSNDHICYFL YQILRGLKYI HSANVLHRDL KPSNLLLNTT CDLKICDFGL ARVADPDHDH TGFLTEYVAT RWYRAPEIML NSKGYTKSID IWSVGCILAE MLSNRPIFPG KHYLDQLNHI LGILGSPSQE DLNCIINLKA RNYLLSLPHK NKVPWNRLFP NADSKALDLL DKMLTFNPHK RIEVEQALAH PYLEQYYDPS DEPIAEAPFK FDMELDDLPK EKLKELIFEE TARFQPGYRS</p>

<p>Recombinant Human DPPA5 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXNDC5 antibody, catalog no. 70R-2551</p>

<p>SP6 antibody was raised in rabbit using the C terminal of SP6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BOP1 antibody, catalog no. 70R-2410</p>

<p>Mouse monoclonal AMACR antibody (C-terminus)</p>

<p>Donkey anti-human IgG (H + L) (HRP) was raised in donkey using human IgG (H&amp;L) as the immunogen.</p>

<p>Goat anti-human IgG (H+L) (Alk Phos) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The CD8 antibody is a monoclonal antibody that plays a crucial role in the immune response. It specifically targets the CD8 protein, which is found on the surface of cytotoxic T cells. This antibody can be used in various life science applications, such as immunoassays and antigen-antibody reactions.</p>

<p>CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD</p>

<p>The XRCC5 antibody is a polyclonal antibody that specifically targets XRCC5, also known as Ku80. XRCC5 is a glycoprotein that plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is commonly used in life sciences research to study the function and localization of XRCC5 in various cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAI14 antibody, catalog no. 70R-4242</p>

<p>FABP1 antibody was raised in mouse using recombinant human FABP1 (1-127aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>SEC5 antibody is a highly versatile growth factor that plays a crucial role in various biological processes. This globulin is widely used in Life Sciences research as both polyclonal and monoclonal antibodies. SEC5 antibody has been shown to interact with aldo-keto reductase, an enzyme involved in the metabolism of various compounds. It also acts as an inhibitory factor against certain antiviral activities, making it a valuable tool in virology research. Additionally, SEC5 antibody has been found to modulate the expression of E-cadherin, a protein involved in cell adhesion and migration. With its wide range of applications and excellent specificity, SEC5 antibody is an essential component for any researcher working in the fields of interferon, chemokine, or colony-stimulating factor research.</p>

<p>The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.</p>

<p>NCOA1 antibody was raised in Rabbit using Human NCOA1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K1 antibody, catalog no. 70R-3666</p>

<p>The CRYAB antibody is a highly specialized monoclonal antibody that targets collagen and other binding proteins. It is commonly used in the field of Life Sciences for various applications. This monoclonal antibody has the unique ability to neutralize reactive and activated growth factors, making it an essential tool for researchers studying cell signaling pathways and protein interactions. Additionally, the CRYAB antibody has demonstrated cytotoxic effects on specific cell types, further expanding its potential applications in cancer research. With its high specificity and affinity, this monoclonal antibody can be easily purified using chromatographic techniques, ensuring optimal performance in experiments. Whether you're investigating hepatocyte growth or glycoprotein function, the CRYAB antibody is a valuable asset that will enhance your research outcomes.</p>

<p>Mouse monoclonal PRPS1 antibody</p>

<p>SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE</p>