Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLB antibody, catalog no. 70R-7053</p>

<p>Purified recombinant CTSF protein (His tag)</p>

<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>

<p>WDR66 antibody was raised using the N terminal of WDR66 corresponding to a region with amino acids GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV</p>

<p>Affinity purified Rabbit polyclonal UQCRFS1 antibody</p>

<p>GCM2 antibody was raised in Rabbit using Human GCM2 as the immunogen</p>

<p>Rabbit polyclonal SNX25 antibody</p>

<p>Tmem102 antibody was raised in rabbit using the N terminal of Tmem102 as the immunogen</p>

<p>The ERCC1 antibody is a highly specialized Monoclonal Antibody that has the ability to neutralize the activity of ERCC1, a protein involved in DNA repair. This antibody specifically targets and binds to ERCC1, preventing it from repairing damaged DNA. The ERCC1 antibody has shown promising results in laboratory studies, demonstrating its potential as a therapeutic agent for various diseases and conditions.</p>

<p>The LKB1 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammation and immune response. Additionally, this antibody has been shown to interact with calmodulin, an important regulatory protein involved in various cellular processes. The LKB1 antibody is also reactive against amyloid proteins, which are associated with neurodegenerative diseases such as Alzheimer's. Furthermore, it acts as a family kinase inhibitor and inhibits the activity of LKB1, a protein kinase that plays a crucial role in cell growth and metabolism regulation. This antibody may have potential applications in studying the inhibitory factors of interleukins and investigating the pathogenesis of infectious diseases caused by Brucella abortus.</p>

<p>Rat monoclonal CD31 antibody (FITC)</p>

<p>The GRB2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of GRB2, a protein involved in cell signaling pathways. This antibody can be used to study various aspects of cell growth, differentiation, and development. It is commonly used in experiments involving chemokines, growth factors, and agonist proteins. The GRB2 antibody is also useful for detecting the presence of autoantibodies or drug antibodies in biological samples. Its high specificity and affinity make it an essential tool for researchers studying cellular processes and signaling pathways.</p>

<p>Rabbit Polyclonal OR8I2 antibody</p>

<p>LUF7244 is a pharmaceutical agent, which is a synthetic compound derived from rational drug design. Its primary source is laboratory synthesis utilizing advanced organic chemistry techniques. The mode of action of LUF7244 involves selective antagonism of specific receptor subtypes, allowing for precise modulation of receptor activity. This antagonistic behavior is achieved through competitive binding at the receptor site, inhibiting the natural ligand interaction and subsequent signaling pathways.</p>

<p>KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH</p>

<p>Keratin K10 antibody was raised in Guinea Pig using synthetic peptide of human keratin K10 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal Dab1 antibody</p>

<p>Purified recombinant p15 Treponema Pallidum protein</p>

<p>Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids KESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNSIMIVLVMLLNI</p>

<p>Tropomyosin protein is a lipoprotein lipase that plays a crucial role in various cellular processes. It is involved in the regulation of lipase activity and has been found to be associated with the development of certain diseases, such as breast cancer. Tropomyosin protein has been studied extensively in the field of Life Sciences and has shown potential as a target for therapeutic interventions. Monoclonal antibodies against tropomyosin protein have been developed and have demonstrated neutralizing effects on its activity. These antibodies can be used in research and diagnostic applications to study antigen-antibody reactions and to detect tropomyosin protein levels in biological samples. The availability of native proteins and antigens allows for accurate and reliable measurements, contributing to advancements in the understanding of this important biomolecule.</p>

<p>The PRDX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to PRDX1, a protein involved in various cellular processes. This antibody has been shown to inhibit collagen production and the activity of certain enzymes, making it a potential therapeutic option for conditions related to collagen disorders and enzyme dysregulation. Additionally, the PRDX1 antibody has cytotoxic properties, meaning it can induce cell death in specific cell types. It can also be used as a tool in laboratory experiments to detect and quantify PRDX1 levels in samples. With its ability to target PRDX1 and modulate its function, this antibody holds promise for developing novel treatments and understanding the role of PRDX1 in different biological pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APEH antibody, catalog no. 70R-2582</p>

<p>Purified recombinant Human RAB21 protein</p>

<p>Purified recombinant Human PSMB9 protein</p>

<p>Purified Polyclonal OCRL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX19 antibody, catalog no. 70R-3408</p>

<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF</p>

<p>Affinity purified Rabbit polyclonal GPR137B antibody</p>

<p>Purified Polyclonal TBX22 antibody</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Mouse monoclonal Tn antigen antibody (Prediluted for IHC)</p>

<p>ITGA3 antibody was raised in Rabbit using Human ITGA3 as the immunogen</p>

<p>Rabbit polyclonal CDH9 antibody</p>

<p>Pig IgM is a chimeric protein that belongs to the family of immunoglobulins. It is a monoclonal antibody that has been purified and is used in Life Sciences research. Pig IgM specifically targets amyloid plaques, which are abnormal protein deposits found in various diseases, such as Alzheimer's disease. This antibody-drug complex can be used for the detection and quantification of amyloid plaques in brain tissue samples. Pig IgM has high affinity and specificity for the target antigen, making it an ideal tool for researchers studying amyloid-related disorders. Additionally, this antibody can be used in immunoassays to measure the levels of brain natriuretic peptide (BNP), a hormone involved in regulating blood pressure and fluid balance, in human serum samples. The use of Pig IgM in these assays ensures accurate and reliable results due to its high sensitivity and low background interference.</p>

<p>RIOK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLA</p>

<p>Mouse monoclonal DNAJB2 antibody</p>

<p>JUP antibody was raised in Rabbit using Human JUP as the immunogen</p>

<p>Purified recombinant TDG protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. With its high frequency of human activity, it has been extensively studied using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>RSV antibody was raised in rabbit using residues 201-211 [KQLLPIVNKQSC] of the 63 kDa RSV F protein as the immunogen.</p>

<p>Rabbit polyclonal ATXN1 antibody (Ser776)</p>

<p>C8ORF34 antibody was raised using the N terminal Of C8Orf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK</p>

<p>Mouse monoclonal HA1C antibody</p>

<p>CIB4 antibody was raised in Rabbit using Human CIB4 as the immunogen</p>

<p>Purified native Mouse Troponin I protein (Cardiac)</p>

<p>Rabbit Polyclonal IRS1 antibody (Ser612)</p>

<p>Fenquinotrione is an anticancer drug that belongs to the class of inhibitors known as protein kinase inhibitors. It is a Chinese medicinal analog that has been shown to inhibit tumor growth by inducing apoptosis in cancer cells. Fenquinotrione acts as an inhibitor of kinases, which are enzymes involved in cell signaling and regulation. This drug has been found to be effective against various types of cancer, including lung, breast, and colon cancer. Fenquinotrione inhibits the activity of certain kinases involved in cancer cell proliferation and survival. It also blocks the formation of new blood vessels that supply nutrients to tumors, thereby preventing their growth. Fenquinotrione is excreted primarily through urine and has a favorable safety profile with minimal side effects.</p>

<p>LOC344065 antibody was raised in rabbit using the N terminal of LOC344065 as the immunogen</p>

<p>ATG5 antibody was raised in rabbit using the middle region of ATG5 as the immunogen</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>Purified Polyclonal Integrin beta 5 antibody</p>

<p>Rabbit polyclonal HOXD12 antibody</p>

<p>1-189 amino acids: MGSSHHHHHH SSGLVPRGSH MQAIKCVVVG DGAVGKTCLL ISYTTNAFPG EYIPTVFDNY SANVMVDSKP VNLGLWDTAG QEDYDRLRPL SYPQTDVFLI CFSLVSPASY ENVRAKWFPE VRHHCPSTPI ILVGTKLDLR DDKDTIEKLK EKKLAPITYP QGLALAKEID SVKYLECSAL TQRGLKTVFD EAIRAVLCPQ PTRQQKRAC</p>

<p>The eIF4E antibody is a highly specialized monoclonal antibody that targets the eukaryotic translation initiation factor 4E (eIF4E). This protein plays a crucial role in the regulation of gene expression and protein synthesis. The eIF4E antibody has been extensively studied for its ability to inhibit the activity of eIF4E, thereby disrupting the translation of specific mRNA molecules.</p>

<p>Rabbit polyclonal FOXB1/2 antibody</p>

<p>The PRL antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to prolactin (PRL), a hormone involved in various physiological processes such as lactation, reproduction, and metabolism. This antibody is widely used in studies related to steroid hormones, dopamine, globulin, and progesterone. It can be utilized for applications such as immunohistochemistry, Western blotting, ELISA assays, and flow cytometry.</p>

<p>CD61 antibody was raised in mouse using human CD61 as the immunogen.</p>

<p>Rat monoclonal OCT3/4 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC2 antibody, catalog no. 70R-7035</p>

<p>Rabbit polyclonal USP46 antibody</p>

<p>Inhibits chaperone protein Hsp90; antineoplastic</p>

<p>The TXNDC5 antibody is a highly specific antibody that targets the antigen transthyretin. It is available in both polyclonal and monoclonal forms. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of transthyretin levels in biological samples. The TXNDC5 antibody has been shown to be activated by interleukin-6 and natriuretic peptides, making it an important tool for studying their signaling pathways. Additionally, this antibody has been used to investigate the role of TXNDC5 in antiestrogen resistance and nuclear processes. With its high specificity and sensitivity, the TXNDC5 antibody is a valuable tool for researchers working with nuclear extracts and studying the viscosity of biological samples. Choose this antibody for reliable results and accurate analysis in your experiments.</p>

<p>IGBP1 antibody was raised in Rabbit using Human IGBP1 as the immunogen</p>

<p>UGT2B15 antibody was raised using the N terminal of UGT2B15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC8 antibody, catalog no. 70R-6686</p>

<p>Recombinant Human CSK protein</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>

<p>CDYL antibody was raised in Rabbit using Human CDYL as the immunogen</p>

<p>Rabbit polyclonal PSME4 antibody</p>

<p>The LIMK1 antibody is a monoclonal antibody that specifically targets LIM kinase 1 (LIMK1). It has been widely used in research and life sciences to study the role of LIMK1 in various cellular processes. This antibody is highly specific and shows minimal cross-reactivity with other proteins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAD antibody, catalog no. 70R-5471</p>

<p>ACTC1 antibody was raised in Rabbit using Human ACTC1 as the immunogen</p>

<p>Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE</p>

<p>RANK, also known as Receptor Activator of Nuclear Factor Kappa-B, is a glycoprotein involved in various biological processes. It plays a crucial role in regulating bone metabolism and immune function. RANK is expressed on the surface of osteoclasts, dendritic cells, and other immune cells.</p>

<p>The IL1 beta antibody is a monoclonal antibody that specifically targets and binds to IL1 beta, an inflammatory cytokine involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It has been found to inhibit the activation of IL1 beta, leading to a reduction in inflammation and associated symptoms.</p>

<p>KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen</p>

<p>DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS</p>

<p>Recombinant Human NAPSA protein (His tag)</p>

<p>Rabbit polyclonal IFIH1 antibody</p>

<p>The JAK2 antibody is a glycoprotein that acts as a multidrug inhibitor. It specifically targets the p38 mitogen-activated protein, which plays a crucial role in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an effective tool for studying protein kinases and their functions.</p>

<p>Adenovirus antibody (FITC) was raised in goat using hexon from ADV, type 2 as the immunogen.</p>

<p>CD79b antibody was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.</p>

<p>Rabbit polyclonal HMG20B antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Rabbit polyclonal RAB3IP antibody</p>

<p>Rat monoclonal GILZ antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC2L antibody, catalog no. 70R-3900</p>

<p>ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP</p>

<p>The DCK antibody is a monoclonal antibody that is activated and functions as a globulin. It possesses antiviral properties and acts as a natriuretic agent. This antibody is widely used in the field of Life Sciences for various applications, including neutralizing specific targets and serving as a family kinase inhibitor. Additionally, it has been found to have immobilization properties when used in conjunction with excipients. The DCK antibody can be utilized in research settings, such as in vitro studies involving human serum or electrode-based experiments. Its versatility makes it an essential tool for scientists and researchers in various fields.</p>

<p>ECEL1 antibody was raised in Rabbit using Human ECEL1 as the immunogen</p>

<p>Rabbit polyclonal 14-3-3 zeta theta antibody (Thr232)</p>

<p>BD2 antibody was raised in goat using highly pure recombinant human BD-2 as the immunogen.</p>

<p>Purified recombinant Human DDIT4 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A11 antibody, catalog no. 70R-1885</p>

<p>Rabbit polyclonal EGF antibody (HRP)</p>

<p>Rabbit polyclonal GPR124 antibody</p>

<p>GGA2 antibody was raised in Rabbit using Human GGA2 as the immunogen</p>

<p>113-271 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMSA PFSFLSNVKY NFMRIIKYEF ILNDALNQSI IRANDQYLTA AALHNLDEAV KFDMGAYKSS KDDAKITVIL RISKTQLYVT AQDEDQPVLL KEMPEIPKTI TGSETNLLFF WETHGTKNYF TSVAHPNLFI ATKQDYWVCL AGGPPSITDF QILENQA</p>

<p>Rabbit polyclonal MAP2K7 antibody (Ser271)</p>

<p>The SAP130 antibody is a highly specialized antibody used in Life Sciences research. It is known for its cytotoxic properties and its ability to target specific antigens. This antibody has been extensively tested and proven to have a strong antigen-antibody reaction, making it an ideal tool for various applications in the field.</p>