Produits biochimiques et réactifs

<p>Rat monoclonal CD115 antibody (biotin)</p>

<p>INPP5A antibody was raised in Rabbit using Human INPP5A as the immunogen</p>

<p>Fibrinogen antibody was raised in Rat using Fibrinogen purified from human blood containing alpha, beta and gamma chains as the immunogen.</p>

<p>Purified recombinant CEND1 protein (His tag)</p>

<p>Rabbit polyclonal TIPIN antibody</p>

<p>Recombinant Human UBE2E3 protein with His tag</p>

<p>KIF1C antibody was raised in Rabbit using Human KIF1C as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCE1 antibody, catalog no. 70R-6268</p>

<p>Purified recombinant ACOT8 protein (His tag)</p>

<p>Rabbit anti-mouse IgG3 (Alk Phos) was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>

<p>MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL</p>

<p>The Candida Albicans Monoclonal Antibody is a highly specific immunohistochemistry reagent that is used for the detection of Candida albicans in various biological samples. This monoclonal antibody is produced using hybridoma technology and recognizes a glycoprotein antigen present on the surface of Candida albicans cells. The Candida Albicans Monoclonal Antibody has been extensively validated for its specificity and sensitivity in detecting Candida albicans in clinical specimens, such as blood, urine, and tissue samples. It offers high affinity and binding specificity, allowing for accurate and reliable results. This antibody can be used in various applications, including immunohistochemistry staining of tissue sections, flow cytometry analysis of cell suspensions, and Western blotting. It provides clear and distinct staining patterns, allowing for easy identification of Candida albicans cells. In addition to its diagnostic applications, the Candida Albicans Monoclonal Antibody has also been used in research studies to investigate</p>

<p>PINK1 antibody was raised in rabbit using residues 258-274 (YRKSKRGPKQLAPHPNI) of human PINK1 as the immunogen.</p>

<p>Mouse monoclonal CHRDL1 antibody</p>

<p>HSPA4L antibody was raised using the middle region of HSPA4L corresponding to a region with amino acids KCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSL</p>

<p>Ccdc90b antibody was raised in rabbit using the N terminal of Ccdc90b as the immunogen</p>

<p>The Flag tag is a versatile tool used in the field of Life Sciences. It consists of a short peptide sequence that can be fused to a protein of interest, allowing for easy detection and purification. The Flag tag has been widely used in various applications such as immunoblotting, immunoprecipitation, and flow cytometry. One of the key advantages of the Flag tag is its high specificity and sensitivity. It can be easily recognized by commercially available monoclonal antibodies, making it ideal for protein detection and quantification. Additionally, the Flag tag does not interfere with the structure or function of the tagged protein, ensuring accurate results. The Flag tag is commonly used in research related to cytokines such as IFN-gamma and TNF-alpha. It has also been utilized in studies involving viscosity measurements, anti-MERTK antibody development, and activation assays. Whether you are working with monoclonal or polyclonal antibodies, the Flag tag provides a reliable target molecule for your experiments. In</p>

<p>VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM</p>

<p>Purified recombinant MAEA protein (His tag)</p>

<p>Rabbit polyclonal RPL11 antibody (HRP)</p>

<p>Mouse monoclonal GSS antibody</p>

<p>CMA1 antibody was raised in Rabbit using Human CMA1 as the immunogen</p>

<p>The PITX1 antibody is a highly specific monoclonal antibody that targets the PITX1 protein. This antibody has been extensively studied and proven to have a high affinity for its target molecule. It can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Purified Polyclonal JIK antibody</p>

<p>The G3BP1 antibody is a monoclonal antibody that specifically targets and binds to the granulosa cell protein G3BP1. This antibody is widely used in the field of Life Sciences for various applications. It has been shown to neutralize the activity of G3BP1, which plays a crucial role in cellular processes such as antigen-antibody reactions, growth factor signaling, and regulation of gene expression. The G3BP1 antibody can be used in experiments to study the function of G3BP1 and its interactions with other proteins, such as β-catenin and glutamate receptors. Additionally, both monoclonal and polyclonal antibodies against G3BP1 are available, providing researchers with options to suit their specific needs.</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>The BEGIN antibody is a highly effective neutralizing monoclonal antibody that targets endothelial growth factor CXCR4. It is widely used in Life Sciences research to study the activation of hepatocyte growth factor and other chemokine binding proteins. The BEGIN antibody has shown exceptional results in inhibiting the growth and proliferation of cells expressing high levels of CXCR4. In addition, it has been proven to effectively bind to other important molecules such as adalimumab, electrode, epidermal growth factor, annexin, and TNF-α. Researchers rely on the BEGIN antibody for its superior specificity and reliability in various experimental settings.</p>

<p>Estrogen antibody was raised in rabbit using estriol - BSA as the immunogen.</p>

<p>Rabbit polyclonal LYPLA1 antibody</p>

<p>The TRIM21 antibody is a versatile and essential tool in the field of Life Sciences. This polyclonal antibody specifically targets CD20, a protein that is expressed on the surface of B cells. By binding to CD20, the TRIM21 antibody can effectively neutralize its function and inhibit B cell activity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of G6PD antibody, catalog no. 70R-3240</p>

<p>The EDG4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the EDG4 receptor, which is involved in various cellular processes such as fatty acid metabolism, caffeine response, and low-density lipoprotein (LDL) cholesterol uptake. This antibody has been extensively studied for its potential therapeutic applications, particularly in the fields of cancer research and immunology.</p>

<p>SLC18A1 antibody was raised in rabbit using the N terminal of SLC18A1 as the immunogen</p>

<p>47-679 amino acids: MGSSHHHHHH SSGLVPRGSH MASEAIKGAV VGIDLGTTNS CVAVMEGKQA KVLENAEGAR TTPSVVAFTA DGERLVGMPA KRQAVTNPNN TFYATKRLIG RRYDDPEVQK DIKNVPFKIV RASNGDAWVE AHGKLYSPSQ IGAFVLMKMK ETAENYLGHT AKNAVITVPA YFNDSQRQAT KDAGQISGLN VLRVINEPTA AALAYGLDKS EDKVIAVYDL GGGTFDISIL EIQKGVFEVK STNGDTFLGG EDFDQALLRH IVKEFKRETG VDLTKDNMAL QRVREAAEKA KCELSSSVQT DINLPYLTMD SSGPKHLNMK LTRAQFEGIV TDLIRRTIAP CQKAMQDAEV SKSDIGEVIL VGGMTRMPKV QQTVQDLFGR APSKAVNPDE AVAIGAAIQG GVLAGDVTDV LLLDVTPLSL GIETLGGVFT KLINRNTTIP TKKSQVFSTA ADGQTQVEIK VCQGEREMAG DNKLLGQFTL IGIPPAPRGV PQIEVTFDID ANGIVHVSAK DKGTGREQQI VIQSSGGLSK DDIENMVKNA EKYAEEDRRK KERVEAVNMA EGIIHDTETK MEEFKDQLPA DECNKLKEEI SKMRELLARK DSETGENIRQ AASSLQQASL KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ</p>

<p>PHP 501 trifluoroacetate is a research tool that can be used to activate or inhibit ion channels and other proteins. It can also be used to study the interactions between proteins and peptides. This product has high purity, is stable at room temperature, and is soluble in water. PHP 501 trifluoroacetate has been used as a ligand for receptor binding studies and as an inhibitor of protein-protein interactions.</p>

<p>Purified recombinant ATP1B2 protein (His tag)</p>

<p>MORC1 antibody was raised in Rabbit using Human MORC1 as the immunogen</p>

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>Rabbit polyclonal RPL36A antibody (biotin)</p>

<p>KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen</p>

<p>DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS</p>

<p>Recombinant Human NAPSA protein (His tag)</p>

<p>Rabbit polyclonal IFIH1 antibody</p>

<p>The JAK2 antibody is a glycoprotein that acts as a multidrug inhibitor. It specifically targets the p38 mitogen-activated protein, which plays a crucial role in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an effective tool for studying protein kinases and their functions.</p>

<p>Adenovirus antibody (FITC) was raised in goat using hexon from ADV, type 2 as the immunogen.</p>

<p>CD79b antibody was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.</p>

<p>Rabbit polyclonal HMG20B antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Rabbit polyclonal RAB3IP antibody</p>

<p>Rat monoclonal GILZ antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC2L antibody, catalog no. 70R-3900</p>

<p>ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP</p>

<p>The DCK antibody is a monoclonal antibody that is activated and functions as a globulin. It possesses antiviral properties and acts as a natriuretic agent. This antibody is widely used in the field of Life Sciences for various applications, including neutralizing specific targets and serving as a family kinase inhibitor. Additionally, it has been found to have immobilization properties when used in conjunction with excipients. The DCK antibody can be utilized in research settings, such as in vitro studies involving human serum or electrode-based experiments. Its versatility makes it an essential tool for scientists and researchers in various fields.</p>

<p>ECEL1 antibody was raised in Rabbit using Human ECEL1 as the immunogen</p>

<p>Rabbit polyclonal 14-3-3 zeta theta antibody (Thr232)</p>

<p>BD2 antibody was raised in goat using highly pure recombinant human BD-2 as the immunogen.</p>

<p>Purified recombinant Human DDIT4 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A11 antibody, catalog no. 70R-1885</p>

<p>Rabbit polyclonal EGF antibody (HRP)</p>

<p>Rabbit polyclonal GPR124 antibody</p>

<p>GGA2 antibody was raised in Rabbit using Human GGA2 as the immunogen</p>

<p>113-271 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMSA PFSFLSNVKY NFMRIIKYEF ILNDALNQSI IRANDQYLTA AALHNLDEAV KFDMGAYKSS KDDAKITVIL RISKTQLYVT AQDEDQPVLL KEMPEIPKTI TGSETNLLFF WETHGTKNYF TSVAHPNLFI ATKQDYWVCL AGGPPSITDF QILENQA</p>

<p>Rabbit polyclonal MAP2K7 antibody (Ser271)</p>

<p>The SAP130 antibody is a highly specialized antibody used in Life Sciences research. It is known for its cytotoxic properties and its ability to target specific antigens. This antibody has been extensively tested and proven to have a strong antigen-antibody reaction, making it an ideal tool for various applications in the field.</p>

<p>Purified recombinant Human DHODH Protein (His tag)</p>

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CENPH antibody, catalog no. 70R-5517</p>

<p>The FAK antibody is a highly effective monoclonal antibody used in Life Sciences. It belongs to the family of antibodies targeting specific growth factors, such as trastuzumab and adalimumab. This antibody specifically targets CD33, a protein expressed on the surface of certain cells. By neutralizing CD33, the FAK antibody inhibits the growth and proliferation of these cells.</p>

<p>Rabbit polyclonal OATP14 antibody</p>

<p>CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG</p>

<p>ALDH1A2 antibody was raised in rabbit using the N terminal of ALDH1A2 as the immunogen</p>

<p>Rabbit polyclonal RAB40B antibody</p>

<p>Affinity purified Rabbit polyclonal STMN2 antibody</p>

<p>The ADCK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the CD33 protein, as well as VEGF (vascular endothelial growth factor). This antibody has shown promising results in inhibiting the growth of various cancer cells, including MCF-7 breast cancer cells. Additionally, it has been found to have cytotoxic effects on mesenchymal stem cells and can neutralize the activity of circumsporozoite protein, which is involved in malaria infection. The ADCK3 antibody also exhibits properties similar to trastuzumab and adalimumab, acting as a family kinase inhibitor and a potent anti-inflammatory agent. Its versatility and effectiveness make it a valuable tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFLTD1 antibody, catalog no. 70R-4170</p>

<p>MAGED1 antibody was raised in Rabbit using Human MAGED1 as the immunogen</p>

<p>MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP</p>

<p>The L1CAM antibody is a monoclonal antibody that specifically targets the L1 cell adhesion molecule (L1CAM), a protein expressed in various tissues. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as an inhibitor of L1CAM-mediated growth factor signaling pathways. It has been used in assays to study the activation of L1CAM and its role in various cellular processes. The L1CAM antibody has also demonstrated cytotoxic activity against cells expressing high levels of L1CAM, making it a potential therapeutic option for certain types of cancer. Additionally, this antibody has been found to have vasoactive properties, potentially affecting vascular function. With its ability to target L1CAM and its diverse range of applications, the L1CAM antibody holds great potential for further research and development in the field of biomedicine.</p>

<p>CDCA7L antibody was raised using the middle region of CDCA7L corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED</p>

<p>Rabbit polyclonal PPME1 antibody</p>

<p>SCN8A antibody was raised using the middle region of SCN8A corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC</p>

<p>Goat anti-rabbit IgG (Fab'2) (Rhodamine) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>Purified recombinant Human APP Protein (His tag)</p>

<p>Rabbit polyclonal STAT4 antibody</p>

<p>MFSD8 antibody was raised in rabbit using the middle region of MFSD8 as the immunogen</p>

<p>Rat monoclonal CD86 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal U2AF35 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R1A antibody, catalog no. 70R-2215</p>

<p>HPS1 antibody was raised in Rabbit using Human HPS1 as the immunogen</p>

<p>Mouse monoclonal TAF12 antibody</p>

<p>Purified Polyclonal MRPL28 antibody</p>

<p>The p53 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>Purified Polyclonal HIC2 antibody</p>

<p>HCV NS5B (2594-2602) is an epitope of the non-structural protein 5B of Hepatitis C Virus. HCV NS5B contains CD8 + T cell epitopes that might be implicated in improvement of immunotherapeutic strategies for efficient vaccine development against HCV.<br>Applications of HCV NS5B (2594-2602):<br>HCV NS5B (2594-2602) is used to stimulate specific-cytotoxic T cell responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells.<br>HCV NS5B (2594-2602) was used as a candidate HCV antigen for vaccine development and CD8 + T cell responses against HCV NS5B (2594-2602) have been detected. Results of ELISPOT assay has shown HCV NS5B (2594-2602)-cytotoxic T cell responses in cells with HLA-A*02:01 type.<br>Potential cross-reactivity with HIV-1 p17 Gag (77-85):<br>Similarities between two HLA-A2-restricted epitopes of two viruses have been demonstrated: the amino acid sequence of HIV-1 p17 Gag (77-85) (SLYNTVATL) and of HCV NS5B (2594-2602) (ALYDVVTKL). Therefore, researches are conducted to know if during HCV/HIV co-infection it could be exist a T cell cross reactivity.</p>

<p>The p70S6 Kinase antibody is a highly effective selectable marker used in various research applications. This antibody is designed to specifically target and bind to p70S6 Kinase, a key enzyme involved in the regulation of protein synthesis and cell growth. It is available as both monoclonal and polyclonal antibodies, providing researchers with options depending on their specific needs.</p>

<p>The SAMHD1 antibody is a highly specialized monoclonal antibody that specifically targets the SAMHD1 protein. This protein plays a crucial role in regulating the cellular dNTP pool, which is essential for DNA replication and repair. By binding to SAMHD1, this antibody can effectively inhibit its function and disrupt the normal cell cycle.</p>

<p>FAM50B antibody was raised using the N terminal of FAM50B corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD</p>

<p>Rabbit polyclonal GRK1 antibody</p>

<p>The SYK antibody is a highly effective polyclonal antibody that is used for various applications. It can be used in research and diagnostic settings to detect and measure the presence of specific proteins or biomarkers. The SYK antibody works by binding to its target protein, sclerostin, which plays a crucial role in bone metabolism. By targeting sclerostin, the SYK antibody helps to inhibit its function and promote bone formation.</p>