Produits biochimiques et réactifs

<p>PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE</p>

<p>Purified recombinant Human ASPA protein (His tag)</p>

<p>FA2H antibody was raised in Rabbit using Human FA2H as the immunogen</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>SAMD14 antibody was raised using the N terminal of SAMD14 corresponding to a region with amino acids HKARAQLLAKGRRHRPSRSRLRDSASSAEDGEGSDGPGGKVTDGCGSPLH</p>

<p>Tuberin antibody is a polyclonal antibody that specifically targets tuberin, a protein involved in the regulation of cell growth and proliferation. This antibody is commonly used in life sciences research to study the role of tuberin in various cellular processes. It has been shown to bind to tyrosine-phosphorylated tuberin and inhibit its interaction with other proteins, such as interleukins and insulin-like growth factors. Tuberin antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their experiments. It can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. This antibody is immobilized on a solid support, making it easy to use for protein-protein interaction studies or detection of tuberin in complex samples. Tuberin antibody is highly specific and sensitive, ensuring accurate and reliable results in your research.</p>

<p>DNAJC7 antibody was raised in Rabbit using Human DNAJC7 as the immunogen</p>

<p>The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>The ICAM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to ICAM1, which stands for Intercellular Adhesion Molecule 1. This protein plays a crucial role in cell adhesion and immune response regulation. The binding of the ICAM1 antibody to ICAM1 can inhibit various cellular processes, including the activation of β-catenin, endonuclease activity, and the production of mitogen-activated protein (MAP) kinases such as p38 MAP kinase.</p>

<p>EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR1B antibody, catalog no. 70R-2934</p>

<p>HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.</p>

<p>MCM8 antibody was raised using the C terminal of MCM8 corresponding to a region with amino acids IRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXF1 antibody, catalog no. 70R-1323</p>

<p>CD49e antibody was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/10 as the immunogen.</p>

<p>KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK</p>

<p>RORC antibody was raised in mouse using recombinant Human Rar-Related Orphan Receptor C</p>

<p>The Cofilin antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein cofilin, which plays a crucial role in cell movement and cytoskeletal dynamics. By binding to cofilin, this antibody allows researchers to study its function and regulation in various cellular processes.</p>

<p>Mouse monoclonal TRAP1 antibody</p>

<p>Rabbit polyclonal PPAR gamma antibody (Ser112)</p>

<p>Hepatitis C Virus antibody was raised in goat using recombinant NS3 (genotype 1a) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZER1 antibody, catalog no. 70R-9767</p>

<p>MTOR antibody was raised in Rabbit using Human MTOR as the immunogen</p>

<p>Sheep polyclonal 17a Trenbolone antibody</p>

<p>Internal standard 3-(2-[4-(4-chlorobenzyl)-1-piperidinyl]ethyl)-2,4-[1h,3H]-quinazoline-dione (R46594)</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BRF2 antibody, catalog no. 70R-8949</p>

<p>DCP1B antibody was raised in rabbit using the N terminal of DCP1B as the immunogen</p>

<p>Affinity purified Rabbit polyclonal COUP TF1 antibody</p>

<p>Rabbit polyclonal RPS10 antibody (biotin)</p>

<p>Rabbit anti-goat IgG (H + L) (biotin) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>The ATF4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the ATF4 protein, which plays a crucial role in cellular response to stress and regulation of gene expression. This antibody has been extensively tested and validated for its specificity and inhibitory properties.</p>

<p>BHMT2 antibody was raised using the middle region of BHMT2 corresponding to a region with amino acids GFVDLPEYPFGLESRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRA</p>

<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP</p>

<p>Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV</p>

<p>IFI30 antibody was raised in Rabbit using Human IFI30 as the immunogen</p>

<p>Rat monoclonal CD4 antibody (FITC); mouse target; IgG2b kappa; clone RM4-4</p>

<p>Purified Polyclonal PNPT1 antibody</p>

<p>HBsAg antibody was raised in mouse using highly purified hepatitis B surface antigen as the immunogen.</p>

<p>Rabbit polyclonal TUBGCP4 antibody</p>

<p>MAN2B2 antibody was raised in Rabbit using Human MAN2B2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NPTX2 antibody, catalog no. 70R-9389</p>

<p>ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA</p>

<p>Rabbit polyclonal SCNM1 antibody</p>

<p>Rabbit polyclonal TNFR3 antibody (HRP)</p>

<p>ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen</p>

<p>The MYO7A antibody is a growth factor that plays a crucial role in adipose tissue development. It is a monoclonal antibody that specifically targets and binds to the MYO7A protein. This antibody has been extensively studied and shown to have high specificity and affinity for MYO7A.</p>

<p>GNB4 antibody was raised in Rabbit using Human GNB4 as the immunogen</p>

<p>Rabbit Polyclonal ABL1/2 antibody (Tyr393/429)</p>

<p>Rabbit polyclonal NP79 antibody</p>

<p>Rabbit polyclonal AurB/C antibody (Thr236/202)</p>

<p>The Menin antibody is a monoclonal antibody that specifically targets the Menin protein. This antibody has been extensively studied and shown to have various functions and applications. It has been found to play a role in insulin regulation, as well as in the regulation of other important cellular processes such as cell growth and differentiation. The Menin antibody has also been used as a tool in research studies to study the function of the Menin protein and its interactions with other molecules. Furthermore, this antibody has potential therapeutic applications, including its use as a neutralizing agent for certain diseases or conditions related to Menin dysregulation. With its high specificity and potency, the Menin antibody is an invaluable tool in the field of Life Sciences for studying and understanding various biological processes.</p>

<p>Rabbit polyclonal FRS2 antibody</p>

<p>Purified native Guinea Pig IgG protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653186 antibody, catalog no. 70R-1184</p>

<p>KLHDC3 antibody was raised in rabbit using the N terminal of KLHDC3 as the immunogen</p>

<p>Mouse monoclonal PDE6G antibody</p>

<p>Rabbit polyclonal PSMD2 antibody</p>

<p>Guk1 antibody was raised in rabbit using the N terminal of Guk1 as the immunogen</p>

<p>Purified recombinant SULT1A2 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FGF21 antibody, catalog no. 70R-6198</p>

<p>CENPH antibody was raised in Rabbit using Human CENPH as the immunogen</p>

<p>BOP1 antibody was raised using the N terminal of BOP1 corresponding to a region with amino acids PLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDG</p>

<p>ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG</p>

<p>LRRC8B antibody was raised using the middle region of LRRC8B corresponding to a region with amino acids  TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE</p>

<p>Mouse monoclonal CD32 antibody (allophycocyanin)</p>

<p>Rabbit Polyclonal PJA2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GEM antibody, catalog no. 70R-1647</p>

<p>GABRA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL</p>

<p>High sensitivity TMB Peroxidase Substrate ready to use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PEBP1 antibody, catalog no. 70R-1036</p>

<p>CD8 antibody was raised in mouse using human CD8 as the immunogen.</p>

<p>MUS81 antibody was raised in Rabbit using Human MUS81 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC729185 antibody, catalog no. 70R-6940</p>

<p>Rabbit polyclonal JHD3B antibody</p>

<p>Purified recombinant Human GNPNAT1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLN8 antibody, catalog no. 70R-7115</p>

<p>Rabbit polyclonal Csk antibody (Ser364)</p>

<p>The S100A3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the S100A3 protein, which is associated with epidermal growth factor and cholinergic signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The S100A3 antibody is known to bind to the S100A3 protein with high affinity, making it an essential tool for studying the role of this protein in cellular processes. Whether you are investigating the effects of androgens on choline acetyltransferase activity or examining the expression of S100A3 in human serum samples, this antibody will provide reliable results. Choose the S100A3 antibody for your research needs and unlock new insights into the intricate mechanisms of cellular function.</p>

<p>EIF3F antibody was raised in rabbit using the C terminal of EIF3F as the immunogen</p>

<p>EMILIN1 antibody was raised in Rabbit using Human EMILIN1 as the immunogen</p>

<p>The GTPBP2 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets GTPBP2, a protein involved in various cellular processes. This antibody can be used to detect the presence of GTPBP2 in samples and study its functions.</p>

<p>Rabbit polyclonal OXCT2 antibody</p>

<p>SIRT4 antibody was raised in rabbit using the middle region of SIRT4 as the immunogen</p>

<p>Rabbit polyclonal RIMS3 antibody</p>

<p>The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.</p>

<p>The SPARC antibody is a highly reactive and neutralizing monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the SPARC protein, which plays a crucial role in various cellular processes such as cell adhesion, migration, and proliferation. This antibody can be used for intraocular applications, as well as in vitro experiments involving chemokine signaling pathways, fatty acid metabolism, fibroin synthesis, and telomerase activity. Additionally, the SPARC antibody has been shown to have potential therapeutic applications in regenerative medicine due to its ability to interact with mesenchymal stem cells and modulate their behavior. Whether you need a recombinant antigen or polyclonal antibodies for your research, the SPARC antibody is an essential tool that can provide valuable insights into cellular mechanisms and contribute to advancements in the field of Life Sciences.</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>Region of IGF BP2 protein corresponding to amino acids EVLFRCPPCT PERLAACGPP PVAPPAAVAA VAGGARMPCA ELVREPGCGC CSVCARLEGE ACQVYTPRCG QGLRCYPHPG SELPLQALVM GEGTCEKRRD AEYGASPEQV ADNGDDHSEG GLVENHVDST MNMLGGGGSA GRKPLKSGMK ELAVFREKVT EQHRQMGKGG KHHLGLEEPK KLRPPPARTP CQQELDQVLE RISTMRLPDE RGPLEHLYSL HIPNCDKHGL YNLKQCKMSL NGQRGECWCV NPNTGKLIQG APTIRGDPEC HLFYNEQQEA RGVHTQRMQ.</p>

<p>Rabbit polyclonal DNA Ligase 4 antibody</p>

<p>Purified Polyclonal BMP3 antibody</p>

<p>Mouse monoclonal Reticulon 1A/B antibody</p>

<p>The Transferrin antibody is a high-quality monoclonal antibody that has neutralizing properties. It is designed to target and bind to transferrin, a protein responsible for iron transport in the body. This antibody is made using advanced techniques and has been extensively tested for its efficacy and safety.</p>

<p>1-130 amino acids: MAEYGTLLQD LTNNITLEDL EQLKSACKED IPSEKSEEIT TGSAWFSFLE SHNKLDKDNL SYIEHIFEIS RRPDLLTMVV DYRTRVLKIS EEDELDTKLT RIPSAKKYKD IIRQPSEEEI IKLAPPPKKA</p>

<p>Rabbit polyclonal NPL antibody</p>

<p>Mouse monoclonal Hepatitis C Virus antibody (core)</p>