Produits biochimiques et réactifs

<p>MUC12 antibody was raised using the middle region of MUC12 corresponding to a region with amino acids PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH</p>

<p>OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC</p>

<p>COL8A1 antibody was raised in Rabbit using Human COL8A1 as the immunogen</p>

<p>ACSM3 antibody was raised in rabbit using the N terminal of ACSM3 as the immunogen</p>

<p>Purified Polyclonal Cerebellin 1 antibody</p>

<p>IRF2BP2 antibody was raised in Rabbit using Human IRF2BP2 as the immunogen</p>

<p>Mouse monoclonal KHK antibody</p>

<p>MIF4GD antibody was raised using the N terminal of MIF4GD corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR</p>

<p>Mouse monoclonal THOP1 antibody</p>

<p>ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF</p>

<p>Rabbit polyclonal F3 antibody (Ser290)</p>

<p>TDP1 antibody was raised in mouse using recombinant human TDP1 (1-298aa) purified from E. coli as the immunogen.</p>

<p>ZNF555 antibody was raised in rabbit using the N terminal of ZNF555 as the immunogen</p>

<p>CCIN antibody was raised in rabbit using the N terminal of CCIN as the immunogen</p>

<p>The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.</p>

<p>Purified Polyclonal Calpain 12 antibody</p>

<p>ZNF778 antibody was raised in rabbit using the N terminal of ZNF778 as the immunogen</p>

<p>Sheep Red Blood Cells (SRBC) are widely used in veterinary applications for various assays and tests. These cells contain fatty acids, anti-HBs antibodies, and other components that make them suitable for different diagnostic purposes. SRBC can be used in immunohistochemistry to detect specific antigens or monoclonal antibodies. They are also commonly used in experiments to measure the activity of cyclase-activating proteins or the production of interferon-gamma (IFN-gamma). Additionally, SRBC have low density, which makes them ideal for certain experimental procedures. Whether you need them for research or clinical applications, Sheep Red Blood Cells provide a reliable and versatile tool for a wide range of veterinary applications.</p>

<p>GSTT1 antibody was raised in Rabbit using Human GSTT1 as the immunogen</p>

<p>Synphilin 1 antibody was raised in goat using a peptide; SLELNGEKDKDKGRTLQRT,  as the immunogen.</p>

<p>Purified Rabbit polyclonal HLAH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2W1 antibody, catalog no. 70R-9892</p>

<p>ETV4 antibody was raised in Mouse using a purified recombinant fragment of human ETV4 (aa50-109) expressed in E. coli as the immunogen.</p>

<p>The EXO1 antibody is a substance that specifically targets and binds to an antigen. It has been extensively studied and proven effective in various research applications. The antibody can be used in gas-liquid interface experiments to study the phosphorylation site of specific proteins. Additionally, it has shown potential as a vaccine strain for the development of new medicines.</p>

<p>Rabbit polyclonal NUDCD2 antibody</p>

<p>Purified Polyclonal NIP7 antibody</p>

<p>PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSCA antibody, catalog no. 70R-8532</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this medication inhibits bacterial growth, preventing transcription and replication. Its bactericidal activity has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>TRAP1 antibody was raised in rabbit using the N terminal of TRAP1 as the immunogen</p>

<p>Purified Polyclonal Neurocan antibody</p>

<p>The BAD antibody is a growth factor that is commonly used in Life Sciences research. It is an amino-terminal globulin that binds to acidic binding proteins. This polyclonal antibody has antiangiogenic properties and can be used to study various signaling pathways, including those involving phosphatase and β-catenin. Additionally, the BAD antibody can be used to detect the presence of specific proteins, such as epidermal growth factor, brain natriuretic peptide, and natriuretic peptides. Its high specificity and sensitivity make it a valuable tool for researchers in the field.</p>

<p>SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP</p>

<p>Purified Polyclonal COL26A1 antibody</p>

<p>The PTBP1 antibody is a monoclonal antibody that specifically targets and inhibits the function of PTBP1, a protein involved in various cellular processes. This antibody can be used as a research tool to study the role of PTBP1 in different biological systems. It is also useful for developing inhibitors or therapeutic antibodies targeting PTBP1 for potential clinical applications. The PTBP1 antibody is widely used in life sciences research, including studies on growth factors, oncogenic kinases, and binding proteins. Its high affinity and specificity make it an ideal tool for experiments involving immobilization on electrodes or other surfaces. By blocking the activity of PTBP1, this antibody can help uncover new insights into the regulation of cellular processes and potentially lead to the development of novel therapies targeting PTBP1-related diseases.</p>

<p>WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ</p>

<p>E. coli antibody was raised in goat using a mixture of E. coli serotypes as the immunogen.</p>

<p>Rabbit Polyclonal APBB3 antibody</p>

<p>Purified Polyclonal IP6K2 antibody</p>

<p>Purified Polyclonal POLR2I antibody</p>

<p>PSCA antibody was raised in rabbit using the C terminal of PSCA as the immunogen</p>

<p>The c-Jun antibody is a powerful tool used in various research applications. It is a polyclonal antibody that specifically targets c-Jun, a protein involved in cell growth and differentiation. This antibody can be used in immunohistochemistry, western blotting, and other experimental techniques to study the expression and localization of c-Jun in different tissues and cell types.</p>

<p>The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.</p>

<p>GSTA4 antibody was raised in Rabbit using Human GSTA4 as the immunogen</p>

<p>SULT2B1 antibody was raised using the N terminal of SULT2B1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI</p>

<p>Rabbit polyclonal JunB antibody (Ser259)</p>

<p>The TYRO3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various research applications involving the detection and analysis of TYRO3 protein. This antibody is designed to specifically target and bind to TYRO3, a receptor tyrosine kinase involved in signal transduction pathways.</p>

<p>SLCO1C1 antibody was raised using the N terminal of SLCO1C1 corresponding to a region with amino acids  VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ</p>

<p>Mouse monoclonal GSC antibody</p>

<p>TFPI2 antibody is a highly specific antibody that targets the TFPI2 molecule. It can be used in various life science applications, including research and diagnostics. This polyclonal antibody has been developed using mass spectrometric methods to ensure its high quality and specificity.</p>

<p>Rabbit polyclonal Vimentin antibody (Ser56)</p>

<p>NDUFA4L2 antibody was raised in Rabbit using Human NDUFA4L2 as the immunogen</p>

<p>Rabbit polyclonal CXCL5 antibody (biotin)</p>

<p>Rabbit polyclonal TSNAX antibody</p>

<p>The CORO1A antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is also available as a monoclonal antibody. This antibody specifically targets the CORO1A protein, which plays a crucial role in various cellular processes.</p>

<p>TYK2 antibody was raised in rabbit using the C terminal of TYK2 as the immunogen</p>

<p>The CD90 antibody is a highly effective tool for research in the field of Life Sciences. It is an activated antibody that specifically targets CD90, also known as alpha-fetoprotein. This antibody has been extensively tested and validated for its ability to inhibit the growth factor associated with CD90, making it an excellent choice for studies focused on understanding the role of CD90 in various biological processes.</p>

<p>1-376 amino acids: MAKQDYYEIL GVSKTAEEHE IRKAYKRLAM KYHPDRNQGD KEAEAKFKEI KEAYEVLTDS QKRAAYDQYG HAAFEQGGMG GGGFGGGADF SDIFGDVFGD IFGGGRGRQR AARGADLRYN MELTLEEAVR GVTKEIRIPT LEECDVCHGS GAKPGTQPQT CPTCHGSGQV QMRQGFFAVQ QTCPHCQGRG TLIKDPCNKC HGHGRVERSK TLSVKIPAGV DTGDRIRLAG EGEAGEHGAP AGDLYVQVQV KQHPIFEREG NNLYCEVPIN FAMAALGGEI EVPTLDGRVK LKVPGETQTG KLFRMRGKGV KSVRGGAQGD LLCRVVVETP VGLNERQKQL LQELQESFGG PTGEHNSPRS KSFFDGVKKF FDDLTR</p>

<p>EIF3I antibody was raised in Rabbit using Human EIF3I as the immunogen</p>

<p>Rabbit polyclonal TAF5L antibody</p>

<p>The CD42b antibody is a highly specialized cysteine-rich protein that plays a crucial role in various cellular processes. This chemokine acts as a cytotoxic agent, inhibiting the growth of unwanted cells and promoting the development of healthy ones. With its ability to bind to specific receptors on adipose tissue, it has been widely used in research related to obesity and metabolic disorders.</p>

<p>Rabbit polyclonal PPIG antibody</p>

<p>Mouse monoclonal PRKD2 antibody</p>

<p>Affinity purified Rabbit polyclonal MAP2K3 antibody</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>Rabbit polyclonal MDC1 antibody (Ser513)</p>

<p>Rabbit polyclonal PFDN1 antibody (FITC)</p>

<p>PARP10 antibody was raised in rabbit using the middle region of PARP10 as the immunogen</p>

<p>HSD11B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRL</p>

<p>The AKT2 antibody is a powerful tool in the field of Life Sciences. It is widely used in various research applications, including electrochemical impedance spectroscopy. This Polyclonal Antibody specifically targets AKT2, a key protein involved in many cellular processes. By binding to AKT2, this antibody can effectively neutralize its activity and provide valuable insights into its function.</p>

<p>The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.</p>

<p>RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GUSB antibody, catalog no. 70R-1858</p>

<p>Region of IFN Gamma protein corresponding to amino acids MQGTLIESLE SLKNYFNSSS MDAMEGKSLL LDIWRNWQKD GNTKILESQI ISFYLRLFEV LKDNQAISNN ISVIESHLIT NFFSNSKAKK DAFMSIAKFE VNNPQIQHKA VNELIRVIHQ LSPESSLRKR KRSRC.</p>

<p>Rabbit polyclonal VEGFC antibody (biotin)</p>

<p>IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ</p>

<p>ACTA1 antibody was raised in rabbit using the C terminal of ACTA1 as the immunogen</p>

<p>Rabbit polyclonal elF4E antibody (Ser209)</p>

<p>Rabbit polyclonal ADCY5/6 antibody</p>

<p>COL6A1 antibody was raised in Rabbit using Human COL6A1 as the immunogen</p>

<p>The PGP9.5 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that targets the protein gene product 9.5 (PGP9.5), also known as ubiquitin carboxyl-terminal hydrolase L1 (UCHL1). This antibody recognizes and binds to PGP9.5, allowing for its detection and quantification in various biological samples.</p>

<p>EHD4 antibody was raised in Rabbit using Human EHD4 as the immunogen</p>

<p>MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD</p>

<p>Purified Polyclonal UBR2 antibody</p>

<p>Purified Polyclonal mGLUR7 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The mechanism of action involves binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified Polyclonal RPS18 antibody</p>

<p>SLFN12 antibody was raised using the N terminal of SLFN12 corresponding to a region with amino acids KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS</p>

<p>Rabbit polyclonal UTP20 antibody</p>

<p>Rabbit polyclonal TRIM44 antibody</p>

<p>The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dys</p>

<p>KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK</p>

<p>MPPED1 antibody was raised in Rabbit using Human MPPED1 as the immunogen</p>

<p>Marcks antibody was raised in Rabbit using Human Marcks as the immunogen</p>

<p>Purified recombinant UBE2Z protein (His tag)</p>

<p>The p70S6K antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of p70S6K, an important protein involved in cell signaling pathways. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>EEF1G antibody was raised using the middle region of EEF1G corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE</p>

<p>C13ORF31 antibody was raised using the middle region of C13Orf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN</p>

<p>Rabbit polyclonal RAB4A antibody</p>

<p>The p53 antibody is a monoclonal antibody that specifically targets the p53 protein, a key regulator of cell growth and division. This antibody is widely used in Life Sciences research for various applications, including immunohistochemical detection and Western blot analysis. The p53 antibody recognizes the carboxy-terminal region of the p53 protein, which includes the tetramerization domain. It has been shown to be highly specific and sensitive in detecting p53 expression levels in human serum samples, making it a valuable serum marker for various diseases and conditions. Additionally, this antibody can also be used to study the role of p53 in different cellular processes, such as apoptosis and DNA repair. Its high affinity and specificity make it an essential tool for researchers studying protein kinases and epidermal growth factor signaling pathways.</p>