Produits biochimiques et réactifs

<p>Rabbit polyclonal KAL1 antibody</p>

<p>ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL</p>

<p>Eif2c3 antibody was raised in rabbit using the N terminal of Eif2c3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNN2 antibody, catalog no. 70R-2395</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF5B antibody, catalog no. 70R-5599</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf68 antibody, catalog no. 70R-4309</p>

<p>Rabbit polyclonal PRNP antibody</p>

<p>Mouse monoclonal DENV2 ED2 antibody</p>

<p>IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK</p>

<p>PRPF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pnpla6 antibody, catalog no. 70R-8660</p>

<p>Region of NP1 protein corresponding to amino acids ACYCRIPACI AGERRYGYCI YQGRLWAFCC.</p>

<p>Rabbit polyclonal HNF4 alpha/gamma antibody</p>

<p>AQYEDGKQYT TLEKPVAGAP QVLEFFSFFC PHCYQFEEVL HISDNVKKKL PEGVKMTKYH VNFMGGDLGK DLTQAWAVAM ALGVEDKVTV PLFEGVQKTQ TIRSASDIRD VFINAGIKGE EYDAAWNSFV VKSLVAQQEK AAADVQLRGV PAMFVNGKYQ LNPQGMDTSN MDVFVQQYAD TVKYLSEKK</p>

<p>GRAP antibody was raised in Rabbit using Human GRAP as the immunogen</p>

<p>The Caspase 1 antibody is a powerful tool used in various assays and research studies in the field of Life Sciences. It is an inhibitor that specifically targets caspase 1, which is a protease involved in the activation of inflammatory cytokines. This antibody can be used to neutralize the activity of caspase 1 and study its role in different cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GDAP2 antibody, catalog no. 70R-4452</p>

<p>Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.</p>

<p>DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF614 antibody, catalog no. 70R-8380</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB15 antibody, catalog no. 70R-9363</p>

<p>The STAT5A antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the STAT5A protein. This protein plays a crucial role in cell signaling pathways and is involved in various biological processes, including cell growth, differentiation, and immune response.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC19 antibody, catalog no. 70R-1957</p>

<p>Purified Polyclonal PECI antibody</p>

<p>The Chlorpyrifos antibody is a growth factor that specifically targets messenger RNA (mRNA) molecules. It is a monoclonal antibody that is designed to detect and bind to contaminants, such as chlorpyrifos, in various samples. This antibody is widely used in the field of Life Sciences for applications such as immunoassays and polymerase chain reactions (PCR). The Chlorpyrifos antibody offers high specificity and sensitivity, making it an ideal choice for researchers and scientists working in environmental monitoring, agriculture, and toxicology. With its excellent chemical stability and long shelf life, this antibody ensures reliable results and consistent performance. Whether you need to detect chlorpyrifos residues or develop a medicament for exposure prevention, the Chlorpyrifos antibody is your go-to solution. Choose from our wide range of options, including gold nanoparticle-conjugated antibodies or polyclonal antibodies, to suit your specific research needs.</p>

<p>Rabbit polyclonal POPDC3 antibody</p>

<p>NFKB2 antibody was raised in Rabbit using Human NFKB2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXCT2 antibody, catalog no. 70R-5373</p>

<p>Affinity purified Rabbit polyclonal BRE antibody</p>

<p>The Estrogen Receptor alpha antibody is a highly effective monoclonal antibody that specifically targets the estrogen receptor alpha (ERα) protein. This antibody plays a crucial role in various biological processes, including cell growth, differentiation, and development. It has been extensively used in research studies to investigate the role of ERα in different diseases and conditions.</p>

<p>Slc26a2 antibody was raised in rabbit using the C terminal of Slc26a2 as the immunogen</p>

<p>The CD66e antibody is a highly specialized antibody that targets the carbonyl group of the HER2 protein. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in the field of Life Sciences. This antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activity, thereby preventing the growth and proliferation of cancer cells.</p>

<p>The GAPDH antibody is a highly effective tool used in Life Sciences research. It is a glycoprotein that specifically targets and binds to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), an enzyme involved in glycolysis. This monoclonal antibody has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>Region of I309 protein corresponding to amino acids SKSMQVPFSR CCFSFAEQEI PLRAILCYRN TSSICSNEGL IFKLKRGKEA CALDTVGWVQ RHRKMLRHCP SKRK.</p>

<p>Purified Recombinant Angiopoietin receptor protein (His tagged)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB7C antibody, catalog no. 20R-1080</p>

<p>Mouse monoclonal SWAP70 antibody</p>

<p>Neomycin-BSA is a unique product in the field of Life Sciences. It is a monoclonal antibody that specifically targets endothelial cadherin, a protein involved in cell adhesion and signaling. This antibody has been extensively studied for its neutralizing properties and has shown promising results in inhibiting the function of endothelial cadherin.</p>

<p>Rat monoclonal CD86 antibody (PE)</p>

<p>The ELTD1 antibody is a highly specialized antibody that targets the ELTD1 protein, which is involved in various biological processes. This antibody is commonly used in life sciences research and has been extensively studied for its role in steroid metabolism. It can be used as a tool for studying the function and localization of ELTD1 in different cell types.</p>

<p>Rabbit polyclonal NXF3 antibody</p>

<p>Plakophilin 3 antibody was raised in Guinea Pig using human recombinant plakophilin 3 peptide purified from E. coli as the immunogen.</p>

<p>Rabbit Polyclonal IkB epsilon antibody (Ser22)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HMGCL antibody, catalog no. 70R-5397</p>

<p>Rabbit polyclonal OLFML2A antibody</p>

<p>Purified recombinant PLSCR3 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXNIP antibody, catalog no. 70R-2031</p>

<p>The SPP1 Blocking Peptide is an activated peptide that falls under the category of Blocking Peptides. It acts as a growth factor and helps regulate the density of low-density lipoproteins in the body. Additionally, it has been shown to reduce cortisol concentration levels and inhibit the binding of vitronectin to certain receptors. The SPP1 Blocking Peptide can be used in various applications such as monoclonal antibody production, electrode coating, and as inhibitors for cortisol or steroid-related experiments. It finds wide usage in the field of Life Sciences and can be combined with other active agents like trastuzumab or other antibodies for enhanced effects.</p>

<p>Mouse monoclonal RAD9A antibody</p>

<p>P2rx2 antibody was raised in rabbit using the middle region of P2rx2 as the immunogen</p>

<p>Please enquire for more information about Niflumic acid-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAC3 antibody, catalog no. 70R-5340</p>

<p>The PSR antibody is a highly specialized monoclonal antibody used in various assays and research studies in the field of Life Sciences. It is specifically designed to target alpha-synuclein (α-syn), a protein associated with neurodegenerative disorders such as Parkinson's disease.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR1L8 antibody, catalog no. 70R-9853</p>

<p>Rabbit polyclonal ERP29 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A8 antibody, catalog no. 70R-1764</p>

<p>Rabbit polyclonal CD3E antibody (FITC)</p>

<p>CIDEC antibody is a polyclonal antibody that is commonly used in life sciences research. It is specifically designed to detect and bind to CIDEC, an antigen that plays a crucial role in lipid metabolism and energy homeostasis. This antibody has been extensively validated for use in immunohistochemistry and other applications.</p>

<p>NAT5 antibody was raised in Rabbit using Human NAT5 as the immunogen</p>

<p>APOBEC3C antibody was raised in Rabbit using Human APOBEC3C as the immunogen</p>

<p>GPR115 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG1 antibody, catalog no. 70R-6636</p>

<p>Affinity purified Rabbit polyclonal RAMP1 antibody</p>

<p>KANK1 antibody was raised in Rabbit using Human KANK1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TADA1L antibody, catalog no. 70R-3587</p>

<p>LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF</p>

<p>Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.</p>

<p>ZNF610 antibody was raised in rabbit using the N terminal of ZNF610 as the immunogen</p>

<p>17a-Estradiol 3 Conjugate for use in competitive ELISA</p>

<p>The Zika virus NS1 antibody is a potent treatment and/or prophylaxis option for individuals exposed to the Zika virus. This antibody specifically targets the NS1 protein found in the virus and effectively neutralizes its harmful effects. It has been extensively tested on human serum samples, demonstrating strong binding affinity with NS1 proteins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BNIP1 antibody, catalog no. 70R-9800</p>

<p>ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ</p>

<p>Affinity purified Rabbit polyclonal TATDN1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAN antibody, catalog no. 70R-4075</p>

<p>SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS</p>

<p>Rabbit polyclonal PKD mu antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF768 antibody, catalog no. 70R-9586</p>

<p>Rabbit polyclonal Major capsid protein L1 antibody (FITC)</p>

<p>E2F3 antibody was raised in rabbit using the C terminal of E2F3 as the immunogen</p>

<p>Rabbit polyclonal Dematin antibody (Ser403)</p>

<p>Purified recombinant CRYZ protein (His tag)</p>

<p>Rabbit polyclonal LRAT antibody</p>

<p>The HPV16 E7 antibody is a dinuclear antibody that specifically targets the human papillomavirus type 16 (HPV16) E7 protein. This antibody is widely used in Life Sciences research to study the expression and function of the HPV16 E7 protein. It can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The HPV16 E7 antibody is produced using an expression plasmid containing the HPV16 E7 gene. It has been extensively validated and shows high specificity and sensitivity for detecting HPV16 E7 protein in human serum or tissue samples. When used in experiments, this monoclonal antibody effectively binds to the HPV16 E7 protein, leading to lysis of cells expressing this viral protein. It can also be used to detect the presence of HPV16 E7 in virus-infected cells or as a tool for studying the role of HPV16 E7 in cellular processes. Furthermore, this antibody has been</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIP3-E antibody, catalog no. 70R-3184</p>

<p>Influenza B antibody was raised in goat using the yamagata strain of influenza B as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PGAM2 antibody, catalog no. 70R-4102</p>

<p>CREB5 antibody was raised in Rabbit using Human CREB5 as the immunogen</p>

<p>N6AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL</p>

<p>The Transferrin antibody is a highly effective and neutralizing monoclonal antibody that is designed to target and inhibit the activity of transferrin. This antibody works by binding to transferrin molecules, preventing them from carrying out their normal functions. By doing so, it effectively neutralizes the activity of transferrin and disrupts processes such as lysis, which are dependent on its function.</p>

<p>Rabbit Polyclonal Tau antibody (Ser235)</p>

<p>ACER1 antibody was raised in rabbit using the C terminal of ACER1 as the immunogen</p>

<p>ICAM-1-IN-1 is a peptide that is used as a research tool in cell biology, pharmacology, and life sciences. It is an inhibitor of ICAM-1, which is a receptor for the integrin LFA-1. ICAM-1-IN-1 inhibits the binding of LFA-1 to ICAM-1 and therefore prevents the activation of adhesion molecules on cells. The inhibition of ICAM-1 has been shown to inhibit ion channels and regulate calcium fluxes in cells.</p>

<p>KCNK5 antibody was raised in Rabbit using Human KCNK5 as the immunogen</p>

<p>CHD1L antibody was raised using the middle region of CHD1L corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL</p>

<p>Purified recombinant Human IFN alpha WA protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNF8 antibody, catalog no. 70R-7869</p>

<p>Purified recombinant ASGR2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPK antibody, catalog no. 70R-1319</p>

<p>The GAB1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the growth factor GAB1. This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>