Produits biochimiques et réactifs

<p>Rabbit polyclonal MAD1 antibody (Ser428)</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR</p>

<p>Rabbit polyclonal RASSF8 antibody</p>

<p>Rabbit polyclonal TGS1 antibody</p>

<p>CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD</p>

<p>CARD8 antibody was raised in mouse using recombinant Human Caspase Recruitment Domain Family, Member 8 (Card8)</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-6264</p>

<p>MPZL2 antibody was raised in Rabbit using Human MPZL2 as the immunogen</p>

<p>Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE</p>

<p>Rabbit polyclonal CDKAL antibody</p>

<p>The Presenilin 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Presenilin 1, a protein involved in the processing of fatty acids and acidic compounds. This antibody has been extensively studied for its role in various cellular processes, including the regulation of interleukin-6, epidermal growth factor, annexin proteins, erythropoietin, and natriuretic factors. Researchers use this antibody to investigate the function and interactions of Presenilin 1 in different biological systems. Additionally, polyclonal antibodies are also available for wider applications. These antibodies are valuable tools for scientists studying growth factors, signaling pathways, and disease mechanisms. With their high specificity and sensitivity, both monoclonal and polyclonal Presenilin 1 antibodies provide reliable results for researchers in need of accurate protein detection and analysis.</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser208)</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (PE)</p>

<p>CCDC22 antibody was raised in Rabbit using Human CCDC22 as the immunogen</p>

<p>Recombinant Human HYKK protein</p>

<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>

<p>Purified recombinant MBP protein (His tag)</p>

<p>Rat monoclonal CD25 antibody (biotin)</p>

<p>The POR antibody is a highly specialized antibody that targets the messenger RNA (mRNA) of the primary amino acid sequence of the POR protein. This antibody is designed to specifically bind to the POR protein and can be used in various research applications, such as Western blotting, immunohistochemistry, or flow cytometry.</p>

<p>The ERK2 antibody is a highly specific monoclonal antibody that targets the extracellular signal-regulated kinase 2 (ERK2). This antibody plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. It is commonly used in research and diagnostic applications to study the activation of ERK signaling pathways.</p>

<p>Erythropoietin protein is a long-acting preparation of endogenous erythropoietin, a hormone that stimulates the production of red blood cells. This protein has been shown to have various effects on different cell types. It regulates the synthesis and secretion of TGF-beta in human hepatocytes, which plays a crucial role in tissue repair and fibrosis. Erythropoietin protein can also modulate chemokine expression and enhance the migration of immune cells to sites of inflammation. Additionally, it has been used as a conjugated protein with monoclonal antibodies for targeted drug delivery. Erythropoietin protein is commonly used in the field of life sciences for research purposes and as an ingredient in pharmaceutical formulations. It can be combined with other drugs such as ketorolac, gabapentin, or imatinib to enhance their therapeutic effects. The formulation may contain excipients like collagen to improve stability and bioavailability. With its diverse applications and potent biological activity</p>

<p>The L1CAM antibody is a highly activated monoclonal antibody that targets CD33, a protein found on the surface of adipose cells. This antibody is reactive and has been extensively studied in the field of Life Sciences. It has been shown to have neutralizing properties, inhibiting the growth factor signaling pathways associated with adipose tissue development. Additionally, this antibody has hepatoprotective effects, protecting liver cells from damage caused by lipofuscin accumulation. The L1CAM antibody can also activate phosphatase and 3-kinase enzymes, which play crucial roles in cellular signaling pathways. With its high specificity and potency, this monoclonal antibody is an excellent tool for research and therapeutic applications in various fields.</p>

<p>ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT</p>

<p>KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR</p>

<p>RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW</p>

<p>Purified recombinant NPPC protein (His tag)</p>

<p>Purified Polyclonal Plexin A2 antibody</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Purified Rabbit polyclonal IKK gamma antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>

<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>

<p>Rabbit polyclonal Osteopontin antibody (biotin)</p>

<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>

<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>

<p>Rabbit polyclonal RCBTB2 antibody</p>

<p>Rabbit polyclonal NA14 antibody</p>

<p>LAD1 antibody was raised in Rabbit using Human LAD1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2D3 antibody</p>

<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL</p>

<p>The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.</p>

<p>E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>The CD3E antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and neutralizes alpha-fetoprotein, a protein complex found in human serum. The CD3E antibody has been extensively studied for its binding properties to steroid binding proteins, particularly those involved in nuclear receptor signaling pathways. This antibody is known for its high affinity and specificity, making it an ideal tool for research and diagnostic applications. Whether you are studying protein-protein interactions or investigating the role of specific molecules in cellular processes, the CD3E antibody is an essential tool in your arsenal. Trust this monoclonal antibody to deliver accurate and reliable results for all your scientific endeavors.</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>The Chlorpromazine antibody is a highly specialized monoclonal antibody that specifically targets and binds to chlorpromazine, a metal-binding protein. This multispecific antibody is designed to recognize and bind to specific lysine and acid residues on chlorpromazine molecules. The Chlorpromazine antibody can be used in various applications, such as immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>Rabbit Polyclonal KIF11 antibody (Thr926)</p>

<p>The DLAT antibody is a highly specialized monoclonal antibody that has been developed for use in various life sciences applications. It is designed to specifically target and bind to DLAT, also known as dihydrolipoamide S-acetyltransferase. This protein plays a crucial role in the function of the pyruvate dehydrogenase complex, which is involved in energy metabolism.</p>

<p>Rabbit polyclonal cRAF antibody (Thr269)</p>

<p>PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD</p>

<p>Mouse monoclonal C16orf72 antibody</p>

<p>Conjugated Benzodiazepine-BSA hapten</p>

<p>Rat monoclonal T and B cell activation antigen antibody (biotin)</p>

<p>Rabbit polyclonal SNAI2 antibody</p>

<p>The TYRO3 antibody is a monoclonal antibody that is widely used in the field of life sciences. It has neutralizing properties and can effectively bind to specific antigens, thereby inhibiting their activity. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH</p>

<p>Rabbit polyclonal UCHL5 antibody</p>

<p>FAM19A3 antibody was raised using the middle region of FAM19A3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV</p>

<p>The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein (CSP) found on the surface of Plasmodium falciparum, the parasite responsible for malaria. This antibody has been shown to inhibit the invasion of red blood cells by the parasite and disrupt its life cycle. It binds to CSP and prevents it from interacting with host cell receptors, thereby preventing infection. The NANP antibody also has potential therapeutic applications in the treatment of other diseases, as it has been found to bind to other proteins such as collagen and tyrosine kinase-like growth factor-2. Its unique properties make it a valuable tool in life sciences research and drug development.</p>

<p>The CHI3L2 protein is a growth factor inhibitor that is commonly used in the field of Life Sciences. It belongs to the class of Conjugated Proteins and can be targeted using monoclonal antibodies. CHI3L2 has been shown to inhibit the activity of oncostatin, sorafenib, and interferon, making it an effective antiangiogenic agent. Additionally, this protein has neutralizing properties and can prevent hemolysis. Its ability to inhibit endothelial growth makes it a valuable tool in research and therapeutic applications. When purchasing CHI3L2 protein, make sure to check for the presence of any excipients that may affect its stability or activity.</p>

<p>B3GALT1 antibody was raised using the N terminal of B3GALT1 corresponding to a region with amino acids MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF</p>

<p>GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE</p>

<p>The SERPINA1 antibody is a monoclonal antibody used in the field of life sciences. It specifically targets alpha-fetoprotein, a family kinase inhibitor that plays a crucial role in various cellular processes. The antibody has been extensively studied and shown to effectively neutralize the growth factor activity of alpha-fetoprotein.</p>

<p>RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN</p>

<p>Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.</p>

<p>SIGLEC6 antibody was raised using the C terminal of SIGLEC6 corresponding to a region with amino acids IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK</p>

<p>KLHL1 antibody was raised in Mouse using a purified recombinant fragment of human KLHL1 expressed in E. coli as the immunogen.</p>

<p>BHLHE41 antibody was raised in Rabbit using Human BHLHE41 as the immunogen</p>

<p>The CD90 antibody is a monoclonal antibody that targets the CD90 antigen, also known as Thy-1. It is widely used in life sciences research to study various cellular processes and functions. The CD90 antibody specifically binds to actin filaments and has been shown to inhibit flavobacterium growth. Additionally, it can be used in conjunction with other antibodies to detect and quantify the expression of GM-CSF (colony-stimulating factor) binding proteins. This versatile antibody is commonly used in immunohistochemistry, flow cytometry, and western blotting applications. Its high specificity and affinity make it an essential tool for researchers studying cell signaling pathways, immune responses, and tissue regeneration.</p>

<p>The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.</p>

<p>Rabbit polyclonal RBP7 antibody</p>

<p>Rabbit Polyclonal LCA5 antibody</p>

<p>PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>Rabbit polyclonal ZNF385D antibody</p>

<p>The CD105 antibody is a monoclonal antibody that is used in various applications related to angiogenesis and antiangiogenic therapy. It specifically targets CD105, also known as endoglin, which is a marker for microvessel density. The CD105 antibody works by binding to the antigen and forming an antigen-antibody complex, which can be detected using different techniques such as fluorescence immunochromatography or polymerase chain reaction (PCR). This specific antibody has been shown to be effective in detecting angiogenic factors and autoantibodies in human serum samples. Its high specificity and sensitivity make it a valuable tool for research and clinical diagnostics.</p>

<p>Rabbit polyclonal BAGE2 antibody</p>

<p>Sheep polyclonal Bovine Transferrin antibody (HRP) conjugated</p>

<p>Mouse monoclonal HDHD2 antibody</p>

<p>WSCD2 antibody was raised using the C terminal of WSCD2 corresponding to a region with amino acids GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>CAD antibody was raised using the C terminal of CAD corresponding to a region with amino acids ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL</p>

<p>The TOP2A antibody is a highly specialized product in the field of Life Sciences. It is an anti-ICOS antibody that specifically targets the TOP2A molecule. This antibody plays a crucial role in various biological processes, including the regulation of adiponectin, collagen, and autoantibodies.</p>

<p>Mouse monoclonal DR3 antibody (biotin)</p>

<p>The DGKA antibody is a highly specialized product in the field of Life Sciences. It is a colloidal inhibitory factor that targets cardiomyocytes. This antibody has been shown to have natriuretic effects when activated, making it a valuable tool for research in cardiovascular physiology. Additionally, the DGKA antibody has been found to possess autoantibodies against annexin A2, which further expands its potential applications. This product is available as a monoclonal antibody and can be used in various experimental setups. It can be conveniently detected using streptavidin-based detection systems and has neutralizing properties that make it suitable for functional studies. Researchers interested in glucagon-related pathways will find this DGKA antibody an indispensable tool for their investigations.</p>

<p>The SGSH antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets oncostatin, a growth factor involved in various cellular processes. The SGSH antibody has shown to have cytotoxic effects on cancer cells by disrupting actin filaments and inhibiting their growth. Additionally, this antibody has been found to interact with other molecules such as anti-CD33 antibodies, osteopontin, taxol, and collagen, further enhancing its therapeutic potential. With its high specificity and potency, the SGSH antibody holds great promise as a targeted therapy against various diseases and is a valuable tool for researchers in the field of molecular biology and biotechnology.</p>

<p>The NAC1 antibody is a highly effective tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets NAC1, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting NAC1 dimers.</p>

<p>Rabbit polyclonal RPH3A antibody</p>

<p>The CSPG4 antibody is a monoclonal antibody that targets the growth factor CSPG4. It is used in various research applications to study the role of CSPG4 in different biological processes. This antibody has been shown to be effective in detecting CSPG4 expression in cells and tissues. Additionally, it can be used for immunoprecipitation, Western blotting, and immunofluorescence assays. The CSPG4 antibody has been validated for use in multiple species and is highly specific, exhibiting minimal cross-reactivity with other proteins. Its high affinity and sensitivity make it a valuable tool for researchers studying the function of CSPG4 in various cellular pathways.</p>

<p>Phencyclidine antibody was raised in mouse using phenocyclidine-BSA as the immunogen.</p>

<p>Rabbit polyclonal Tubulin gamma antibody</p>

<p>Plasminogen protein is a crucial component in the field of Life Sciences. It is a cationic protein that plays a vital role in various biological processes. Plasminogen is involved in the breakdown of fibrinogen, which is essential for blood clotting and wound healing. Additionally, it regulates other proteins such as myostatin and natriuretic peptides, contributing to muscle growth and cardiovascular health. This protein can be found in human serum and has been extensively studied for its cytotoxic properties. Plasminogen has shown potential as a therapeutic target for diseases involving excessive tissue damage, such as cancer and inflammation. Furthermore, it interacts with elastase protein and lipoprotein lipase, further highlighting its significance in maintaining cellular homeostasis. For researchers and scientists looking to study or develop assays related to Native Proteins &amp; Antigens, plasminogen protein is an essential tool. It can be used as a positive control or standard in various experimental setups. Additionally,</p>

<p>Purified recombinant NCR3 protein (His tag)</p>

<p>AHCTF1 antibody was raised in mouse using recombinant Human At Hook Containing Transcription Factor 1 (Ahctf1)</p>

<p>Recombinant Human ppiA protein (His tag)</p>

<p>DOR1 antibody was raised in rabbit using a synthetic peptide comprising residues 3-17 LVPSARAELQSSPLV of the mouse and rat DOR-1 protein as the immunogen.</p>

<p>The Lamin A antibody is a highly specialized monoclonal antibody that targets the lamin A protein. Lamin A is a key component of the nuclear lamina, which provides structural support to the nucleus and plays a crucial role in various cellular processes. This antibody specifically recognizes and binds to lamin A, allowing for its detection and analysis in different cell types.</p>