Produits biochimiques et réactifs

<p>KIF19 antibody was raised in Rabbit using Human KIF19 as the immunogen</p>

<p>Rabbit polyclonal SDCG1 antibody</p>

<p>Rovatirelin is a drug that is used as a diagnostic agent to measure the levels of luteinizing hormone (LH) in humans. It has been shown to have anticancer effects on various types of cancer cells in vitro and in vivo, including ovarian, prostate, breast, and colon cancers. Rovatirelin can be used to increase the metabolic rate of oral drugs and is an analog of the natural hormone luteinizing hormone-releasing hormone (LHRH). This drug also stimulates locomotor activity in animals.</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Ciwujianoside C3 is a triterpenoid saponin that has been shown to have anti-inflammatory properties. It inhibits the production of tumor necrosis factor-α (TNF-α) and prostaglandin E2 (PGE2) in BV2 microglial cells. Ciwujianoside C3 also blocks the transcription and polymerase chain reaction of pro-inflammatory genes. This compound is extracted from the Chinese herb, which has been used for centuries as an herbal remedy for inflammatory diseases in China. The extract contains at least two ciwujianosides, including ciwujianoside C3.<br>Ciwujianoside C3 is soluble in water and sodium carbonate. In tissue culture experiments, it was found to be nontoxic up to a concentration of 100 µg/mL.</p>

<p>Purified Rabbit polyclonal CEP41 antibody</p>

<p>Rabbit polyclonal Mcleod Syndrome antibody</p>

<p>SCH-1473759 is a peptide that is an inhibitor of the receptor tyrosine kinase, which binds to the extracellular domain of the receptor and blocks the activation of the receptor. SCH-1473759 has been shown to inhibit tumor growth in vitro and in vivo. This drug also inhibits the function of ion channels and may be used as a research tool for studying protein interactions. SCH-1473759 is not absorbed when taken orally, so it can be administered intravenously or intramuscularly. It is one of few antibodies that have shown no side effects in human clinical trials.</p>

<p>TAK-828F is a monoclonal antibody that targets IL-17A. IL-17A is an inflammatory cytokine that has been shown to play a role in the development of autoimmune diseases and bowel disease. TAK-828F binds to IL-17A with high affinity and specificity, inhibiting its inflammatory effects on the immune system. TAK-828F was studied in clinical trials for use in the treatment of Crohn's disease, ulcerative colitis, and psoriasis. The drug was successful in treating Crohn's disease and psoriasis but not ulcerative colitis. TAK-828F is currently being developed for use as a treatment for inflammatory bowel disease and other autoimmune diseases.</p>

<p>PKR-IN-c51 is a peptide that has been shown to activate PKR in a variety of mammalian cell lines. It also inhibits the binding of PKR to the double-stranded RNA (dsRNA) and prevents the activation of NFκB by dsRNA. This peptide is a potent inhibitor of PKR activation, but has little effect on PKC activity. PKR-IN-c51 can be used as a research tool for studying protein interactions and receptor signaling pathways.</p>

<p>Umbralin is a natural inhibitor of ion channels and ligand-gated ion channels. Umbralin binds to the receptor site, blocking the receptor. It has been shown to be an activator of G-protein coupled receptors. Umbralin is a peptide that is purified from the bark of the tree Croton lechleri, which is native to South America. Umbralin can be used as a research tool for studying protein interactions, receptor activation, and ion channel function in cell biology and neuroscience, as well as for developing new drugs for various applications (e.g., Parkinson's disease).</p>

<p>The V5 Tag antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets the V5 epitope tag, which is commonly used in protein research and expression studies. This antibody can be used for various applications such as immunoblotting, immunoprecipitation, and immunofluorescence assays.</p>

<p>LRRC37A3 antibody was raised using the middle region of LRRC37A3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS</p>

<p>Affinity purified Goat polyclonal MSR Type 1 antibody</p>

<p>The Cry1 antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to the Cry1 protein, which is involved in various cellular processes such as tyrosine phosphorylation and growth factor signaling. This antibody is colloidal gold-conjugated, making it easily detectable in experiments using techniques such as immunohistochemistry or Western blotting.</p>

<p>CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>The SRR antibody is a monoclonal antibody that is specifically designed for the detection and neutralization of insulin. It is commonly used in research and clinical settings to study hyperinsulinaemic hypoglycaemia, a condition characterized by abnormally high levels of insulin in the blood. The SRR antibody is produced through chemical synthesis or recombinant technology using human insulin as the antigen. It has been extensively validated using techniques such as polymerase chain reaction (PCR) and racemase assays to ensure its specificity and reliability. This monoclonal antibody can be used to detect insulin in various samples, including serum, plasma, and tissue extracts. Additionally, it has been shown to have neutralizing activity against insulin, making it a valuable tool for studying the effects of insulin antibodies and autoantibodies in human insulin preparations. With its high affinity for insulin and ability to recognize specific amino acid residues, the SRR antibody offers precise and accurate results for insulin-related research applications.</p>

<p>Rabbit polyclonal MEF2D antibody (Ser444)</p>

<p>Purified Rabbit polyclonal MOT12 antibody</p>

<p>Rabbit polyclonal SYT4 antibody</p>

<p>CD3e antibody (Allophycocyanin) was raised in rat using CD3e as the immunogen.</p>

<p>WAY 100635 is a selective 5-HT2 receptor antagonist with high affinity for the α-subunit of the 5-HT2 receptors. WAY 100635 blocks the activation of these receptors by serotonin and other agonists and has been shown to have no effect on dopamine release or binding at dopaminergic sites. This agent has been shown to have a significant effect on locomotor activity in rats, as well as on concentrations of serotonin in the hippocampus. WAY 100635 is also used as a model system for studying the effects of drugs that interact with 5-HT2 receptors. In this system, WAY 100635 binds selectively to 5-HT2A receptors and prevents their activation by serotonin, which results in an increase in extracellular levels of dopamine in the nucleus accumbens.</p>

<p>RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIE</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>ARN19874 is a fluorescent analog of the endogenous fatty acid, arachidonic acid. It has been shown to bind to the endocannabinoid receptor and inhibit lipolysis in vitro. ARN19874 also inhibits the activity of various lipases, including pancreatic lipase, which may help in the treatment of obesity.</p>

<p>The Yellow Fever Virus NS1 protein is a key component in the study of yellow fever virus and its effects on the human body. It has been found to have anti-glial fibrillary acidic properties, meaning it can inhibit the growth of glial cells in the brain. Additionally, it has been shown to interact with various receptors and factors in the body, such as the growth hormone receptor and interleukin-6 inhibitory factor. This protein is often used in research and scientific studies related to yellow fever virus, as well as in the development of diagnostic tests and therapies. Monoclonal antibodies targeting this protein have been developed for use in neutralizing the virus and detecting its presence in human serum. Recombinant forms of this protein are also used for various applications in Life Sciences, including conjugated proteins for specific assays. Overall, the Yellow Fever Virus NS1 protein is a crucial tool for understanding and combating yellow fever virus infections.</p>

<p>NCX 1000 is a guanylate cyclase activator that has been shown to be effective in the treatment of symptoms of overactive bladder. It is a soluble guanylate cyclase activator that increases the sensitivity of the receptor site, leading to increased intracellular levels of cGMP. NCX 1000 has been shown to be an effective treatment for overactive bladder and can be used in conjunction with other drugs such as gabapentin or noradrenaline. NCX 1000 also has numerous other effects including increasing reaction time and improving muscle function. The experimental model for this drug is detrusor muscle from rats treated with carbon tetrachloride or sodium channel modulators, which are known to cause bladder dysfunction.</p>

<p>Mouse RBC antibody was raised in rabbit using murine erythrocytes as the immunogen.</p>

<p>(Carbethoxymethylene)triphenylphosphorane-13C2 is a ligand that binds to ion channels. The chemical structure of the ligand is (Carbethoxymethylene)triphenylphosphorane-13C2. It has a molecular weight of 356.85 and a CAS number of 90830-64-1. This product is available for purchase as a research tool for use in Cell Biology, Antibodies, and Protein interactions.</p>

<p>Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>17-Hydroxy-17-(1-propyn-1-yl)estra-4,9-dien-3-one is a synthetic peptide that is a potent inhibitor of the protein interactions of the follicle stimulating hormone receptor (FSHR). The molecular structure of 17OHPED is similar to that of GnRH, and it is an agonist at the FSHR. 17OHPED has been shown to activate LHRH release in vitro and in vivo with large potency. It has also been shown to be a highly potent inhibitor of FSHR binding to its ligand, FSH. This compound can be used as a research tool for studying the interaction between proteins.</p>

<p>ZK 261991 is a histone deacetylase inhibitor that has been shown to inhibit cell growth in vitro. It was also shown to have an inhibitory effect on the growth of pancreatic cancer cells in vivo and could be used as an adjuvant therapy for resection of pancreatic cancer. ZK 261991 is a potent inhibitor of the epidermal growth factor receptor, which is a tyrosine kinase receptor that is involved in the signaling pathway for cell proliferation and differentiation.</p>

<p>N-Nitrosopendimethalin is a potent inhibitor of kinase activity, which is essential for the function of many proteins in the human body. It is an analog of a medicinal compound that has been shown to induce tumor cell apoptosis and has potential as an anticancer agent. N-Nitrosopendimethalin inhibits the activity of Chinese hamster ovary cell kinases, which are involved in cancer cell proliferation and survival. This compound has also been detected in urine samples, indicating its potential as a biomarker for cancer diagnosis and monitoring. As an inhibitor of protein kinases, N-Nitrosopendimethalin shows promise as a therapeutic agent for various types of cancer.</p>

<p>Inhibitor of PKCβ kinase</p>

<p>Mouse monoclonal SORD antibody</p>

<p>Rat monoclonal CD45RB antibody (PE)</p>

<p>Activator of PDK1 kinase</p>

<p>MGMT antibody was raised in Rabbit using Human MGMT as the immunogen</p>

<p>The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>EB-3D is a small-molecule inhibitor of choline uptake and biosynthesis that has been shown to inhibit tumor cell growth. EB-3D binds to the CB2 receptor, which is found in cells of the immune system. The EB-3D molecule also inhibits cellular senescence by blocking the activity of amp-activated protein kinase (AMPK) in human breast cancer cells. In vivo studies have shown that EB-3D inhibits tumor growth in mice with mda-mb-231 breast cancer cells.</p>

<p>ERAP1-IN-1 is a peptide that is used as a research tool for studying protein interactions. This peptide can be used to inhibit the activity of the ligand and receptor on a cell membrane. In addition, ERAP1-IN-1 can be used as an antibody immunogen or as a reagent in pharmacological experiments. The chemical name for this compound is (CAS No. 865273-97-8).</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>Please enquire for more information about Racecadotril-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified native Pig Troponin I protein (Skeletal Muscle)</p>

<p>Lagosin is a polyene antibiotic that has been shown to have antimicrobial activity against Gram-positive and Gram-negative bacteria. This drug has been used in the treatment of infectious diseases, such as septicemia or meningitis caused by bacterial infections. Lagosin is active against bacteria that are resistant to other antibiotics because it interacts with the cell wall and causes cell lysis. The mechanism of action for Lagosin is similar to that of amphotericin B and nystatin, which are also polyene antibiotics. The antibacterial activity of this drug may be due to its ability to interact with cells and cause cell lysis. Lagosin has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.</p>

<p>PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE</p>

<p>TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF</p>

<p>ApoC-I antibody was raised in goat using full-length recombinant apolipoprotein type C-I produced as the immunogen.</p>

<p>Purified recombinant SSX1 protein (His tag)</p>

<p>GPT2 antibody was raised in Rabbit using Human GPT2 as the immunogen</p>

<p>TRPA1 antibody was raised using the middle region of TRPA1 corresponding to a region with amino acids KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL</p>

<p>CD49e antibody (FITC) was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/9 as the immunogen.</p>

<p>Purified recombinant DDX39A protein (His tag)</p>

<p>CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>The p300 antibody is a highly specialized antibody that is commonly used in the field of Life Sciences. It is an acidic, polyclonal antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied and shown to have neutralizing and inhibitory effects on certain factors, making it a valuable tool for researchers.</p>

<p>Bio-013077-01 is a bioactive compound, which is a naturally derived product sourced from marine organisms. Its mode of action involves functioning as an enzyme inhibitor, capable of selectively binding to specific target enzymes and altering their activity. This mechanism allows it to modulate biochemical pathways that are crucial for various physiological and pathological processes.</p>

<p>Recombinant Human CCBL1 protein with His tag</p>

<p>Rabbit polyclonal GPR157 antibody</p>

<p>ERK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CBDA 510 bS is a medicinal compound that acts as a kinase inhibitor and analog. It has been shown to induce apoptosis in cancer cells, making it a promising anticancer agent. CBDA 510 bS inhibits the activity of kinases involved in cell cycle regulation and protein synthesis, leading to decreased tumor growth. Additionally, it has been found to inhibit the growth of Chinese hamster ovary cells and human colon cancer cells. This compound may also have potential as an inhibitor of xylan-degrading enzymes, which could be useful in the development of new cancer therapies. With its potent anticancer properties, CBDA 510 bS is an exciting new area of research for those looking for effective cancer treatments.</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>2-Chloro-N4-(4-methoxybenzyl)pyridine-3,4-diamine (CAS No. 881844-10-6) is an inhibitor of the receptor tyrosine kinase cMet and has been shown to inhibit the proliferation of tumor cells in culture. It inhibits the binding of ligand to cMet, which prevents activation of downstream signaling pathways that lead to cell proliferation.</p>

<p>Morzid is a potent kinase inhibitor that has shown promising results in the treatment of various types of cancer. It works by blocking the activity of certain enzymes that are involved in the growth and survival of cancer cells. Morzid has been shown to be effective in inhibiting tumor growth and inducing apoptosis in human cancer cells. This medicinal compound is an analog of iloprost, which is used to treat peripheral vascular disease. Morzid has also been found to have anticancer effects in Chinese hamster ovary cells. In addition, it has been detected in urine samples from patients treated with this drug, indicating its potential as a diagnostic tool for cancer detection and monitoring.</p>

<p>H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>MRS 1334 is a potent inhibitor of the cyclase enzyme adenylate cyclase. It also inhibits the release of calcium from the endoplasmic reticulum. MRS 1334 has been shown to reduce skin inflammation in animal models and to have potential for use as a treatment for psoriasis. This drug has demonstrated activity against cancer cell lines and may be useful for treating cancers that are resistant to other treatments. MRS 1334 binds to the α subunit of adenosine receptors, which reduces the production of growth factors such as TNF-α, IL-1β, IL-2, and IL-6. This drug also inhibits carcinoma cells by interfering with their ability to produce adenosine nucleotides.</p>

<p>SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL</p>

<p>CD79b antibody (PE) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.</p>

<p>The MAP2K2 antibody is a highly effective monoclonal antibody that has neutralizing properties. It acts by targeting and inhibiting the activity of MAP2K2, a protein involved in cellular signaling pathways. This antibody is particularly useful in studies involving antibodies, autoantibodies, interferon, and colony-stimulating factors. It has been extensively tested on various cell lines, including MCF-7 cells, and has shown excellent results in blocking the activity of MAP2K2. Additionally, this antibody has been found to have inhibitory effects on antiphospholipid antibodies and other factors that contribute to disease progression. With its high specificity and potency, the MAP2K2 antibody is an invaluable tool for researchers studying signal transduction pathways and developing targeted therapies.</p>

<p>SB-649868 is a drug in clinical development for the treatment of sleep-wake disorders. It is a potent and selective allosteric modulator of the GABAA receptor, with a profile that includes high affinity for the α1β2γ2 subtype. SB-649868 has been shown to increase slow wave sleep and delta power during wakefulness in healthy human subjects. SB-649868 has also been shown to have no effect on blood pressure or heart rate at clinically relevant doses, suggesting reduced risk for cardiovascular side effects.<br>SB-649868 was well tolerated in preclinical studies, without serious adverse events observed.</p>

<p>Rabbit polyclonal SCN2B antibody</p>

<p>Rabbit Polyclonal GPT antibody (biotin)</p>

<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>

<p>Please enquire for more information about CTAP including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>EGFR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Please enquire for more information about Pomalidomide 4'-alkylc7-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ST 198 is an antimicrobial agent that has been shown to be long-term treatment for humans. It reduces the incidence of antimicrobial resistance by acting as a reactive agent that binds to dopamine, which prevents its reuptake into the cell. ST 198 has also been shown to have no effect on locomotor activity and gene analysis in mice with psychotic disorder. ST 198 is an experimental drug that is being developed for use in diagnostic tests for Neisseria meningitidis and other bacterial infections.<br>ST 198 has been shown to inhibit the receptor activity of bacteria, including the n. meningitidis strain, which can lead to a decrease in the severity of symptoms and duration of illness if administered early during an infection.</p>

<p>Rabbit polyclonal SDP3 antibody (HRP)</p>

<p>TAAR5 antibody was raised in rabbit using the C terminal of TAAR5 as the immunogen</p>

<p>CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.</p>

<p>Inhibitor of nitric oxide production; inhibitor of β-amyloid aggregation</p>

<p>CD11b antibody (FITC) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>VU 0360223 is a selective positive allosteric modulator of the metabotropic glutamate receptor subtype 5 (mGluR5), a type of receptor found in the central nervous system. Synthesized through medicinal chemistry efforts, it serves as a tool compound for neuroscientific research related to glutamatergic signaling.</p>

<p>CD45RO Monoclonal Antibody (HRP)</p>

<p>Please enquire for more information about Cabergoline-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Beta catenin antibody is a highly versatile antibody that plays a crucial role in various biological processes. It is commonly used in life sciences research, particularly in the field of pluripotent stem cells. This antibody specifically targets β-catenin, a protein that is involved in cell adhesion and signaling pathways.</p>

<p>BDP FL DBCO is a synthetic peptide that binds to the GABA receptor. BDP FL DBCO is used in cell biology and research as an inhibitor of ion channels, ligand for the GABA receptor, or as a reagent to detect antibodies against GABA receptors.</p>

<p>Please enquire for more information about Desethyl hydroxychloroquine-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.</p>

<p>The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.</p>

<p>CD11a antibody (biotin) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>16:0-16:0-d31 Pc is a synthetic peptide that is used as an inhibitor of 16:0-16:0 binding to the receptor. The peptide has been shown to bind to the ligand binding domain in the extracellular loop of the receptor and prevent it from activating the ion channels. This peptide is also used as a research tool for studying protein interactions, and can be used in pharmacology, life science, and cell biology.</p>

<p>CD41a antibody (biotin) was raised in ouse using human PBL as the immunogen.</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>

<p>Rabbit polyclonal THOC7 antibody</p>

<p>Inhibitor of HMG-CoA reductase</p>

<p>Rabbit polyclonal HS71L antibody</p>

<p>HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR</p>