Produits biochimiques et réactifs

<p>Purified recombinant MUP1 protein (His tag)</p>

<p>Purified Recombinant Dengue 2 protein</p>

<p>FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA</p>

<p>TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ</p>

<p>Purified recombinant CSDC2 protein (His tag)</p>

<p>Purified recombinant SURF2 protein (His tag)</p>

<p>Purified Polyclonal EEF2K antibody</p>

<p>AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KCNA5 antibody was raised in rabbit using the N terminal of KCNA5 as the immunogen</p>

<p>Rat monoclonal CD45R antibody (PE)</p>

<p>Purified Polyclonal ZADH2 antibody</p>

<p>The SOCS3 antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and specifically targets autoantibodies. The antibody works by inhibiting the glycosylation process and blocking the activity of the phosphatase enzyme. Additionally, it has been shown to effectively neutralize the action of various growth factors.</p>

<p>Rabbit polyclonal STK16 antibody</p>

<p>Purified Polyclonal CIB4 antibody</p>

<p>Rabbit polyclonal MAD1 antibody (Ser428)</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR</p>

<p>Rabbit polyclonal RASSF8 antibody</p>

<p>Rabbit polyclonal TGS1 antibody</p>

<p>CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD</p>

<p>CARD8 antibody was raised in mouse using recombinant Human Caspase Recruitment Domain Family, Member 8 (Card8)</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-6264</p>

<p>MPZL2 antibody was raised in Rabbit using Human MPZL2 as the immunogen</p>

<p>Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE</p>

<p>Rabbit polyclonal CDKAL antibody</p>

<p>The Presenilin 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Presenilin 1, a protein involved in the processing of fatty acids and acidic compounds. This antibody has been extensively studied for its role in various cellular processes, including the regulation of interleukin-6, epidermal growth factor, annexin proteins, erythropoietin, and natriuretic factors. Researchers use this antibody to investigate the function and interactions of Presenilin 1 in different biological systems. Additionally, polyclonal antibodies are also available for wider applications. These antibodies are valuable tools for scientists studying growth factors, signaling pathways, and disease mechanisms. With their high specificity and sensitivity, both monoclonal and polyclonal Presenilin 1 antibodies provide reliable results for researchers in need of accurate protein detection and analysis.</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser208)</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (PE)</p>

<p>CCDC22 antibody was raised in Rabbit using Human CCDC22 as the immunogen</p>

<p>Recombinant Human HYKK protein</p>

<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>

<p>Purified recombinant MBP protein (His tag)</p>

<p>Rat monoclonal CD25 antibody (biotin)</p>

<p>The POR antibody is a highly specialized antibody that targets the messenger RNA (mRNA) of the primary amino acid sequence of the POR protein. This antibody is designed to specifically bind to the POR protein and can be used in various research applications, such as Western blotting, immunohistochemistry, or flow cytometry.</p>

<p>The ERK2 antibody is a highly specific monoclonal antibody that targets the extracellular signal-regulated kinase 2 (ERK2). This antibody plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. It is commonly used in research and diagnostic applications to study the activation of ERK signaling pathways.</p>

<p>Erythropoietin protein is a long-acting preparation of endogenous erythropoietin, a hormone that stimulates the production of red blood cells. This protein has been shown to have various effects on different cell types. It regulates the synthesis and secretion of TGF-beta in human hepatocytes, which plays a crucial role in tissue repair and fibrosis. Erythropoietin protein can also modulate chemokine expression and enhance the migration of immune cells to sites of inflammation. Additionally, it has been used as a conjugated protein with monoclonal antibodies for targeted drug delivery. Erythropoietin protein is commonly used in the field of life sciences for research purposes and as an ingredient in pharmaceutical formulations. It can be combined with other drugs such as ketorolac, gabapentin, or imatinib to enhance their therapeutic effects. The formulation may contain excipients like collagen to improve stability and bioavailability. With its diverse applications and potent biological activity</p>

<p>The L1CAM antibody is a highly activated monoclonal antibody that targets CD33, a protein found on the surface of adipose cells. This antibody is reactive and has been extensively studied in the field of Life Sciences. It has been shown to have neutralizing properties, inhibiting the growth factor signaling pathways associated with adipose tissue development. Additionally, this antibody has hepatoprotective effects, protecting liver cells from damage caused by lipofuscin accumulation. The L1CAM antibody can also activate phosphatase and 3-kinase enzymes, which play crucial roles in cellular signaling pathways. With its high specificity and potency, this monoclonal antibody is an excellent tool for research and therapeutic applications in various fields.</p>

<p>ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT</p>

<p>KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR</p>

<p>RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW</p>

<p>Purified recombinant NPPC protein (His tag)</p>

<p>Purified Polyclonal Plexin A2 antibody</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Purified Rabbit polyclonal IKK gamma antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>

<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>

<p>Rabbit polyclonal Osteopontin antibody (biotin)</p>

<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>

<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>

<p>Rabbit polyclonal RCBTB2 antibody</p>

<p>Rabbit polyclonal NA14 antibody</p>

<p>LAD1 antibody was raised in Rabbit using Human LAD1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2D3 antibody</p>

<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL</p>

<p>The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.</p>

<p>E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>The CD80 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets CD80, a protein involved in immune responses. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The CK17 antibody is a highly specific monoclonal antibody that targets the influenza hemagglutinin protein. It is commonly used in Life Sciences research to study the expression and localization of this important target molecule. The CK17 antibody has been shown to bind specifically to collagen, a major component of connective tissues, and can be used to detect collagen expression in various cell types. Additionally, this antibody has been used to study the regulation of messenger RNA (mRNA) levels for hepatocyte growth factor and ferritin, which are involved in iron homeostasis. The CK17 antibody derivative also inhibits the activity of steroid hormones and growth factors, making it a valuable tool for studying their effects on cellular processes. With its high specificity and versatility, the CK17 antibody is an essential reagent for any researcher working in the field of molecular biology or immunology.</p>

<p>Mouse monoclonal Phycoerythrin antibody (biotin)</p>

<p>Purified recombinant ORM2 protein (His tag)</p>

<p>MAETDPKTVQ DLTSVVQTLL QQMQDKFQTM SDQIIGRIDD MSSRIDDLEK NIADLMTQAG VEELESENKI PATQKS</p>

<p>Androstenedione antibody was raised in rabbit using 4-androstene 3,17-dione-11-protein conjugate as the immunogen.</p>

<p>APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS</p>

<p>RELM beta antibody was raised in using highly pure recombinant human RELMbeta as the immunogen.</p>

<p>MYOD1 antibody was raised in Mouse using a purified recombinant fragment of human MYOD1 expressed in E. coli as the immunogen.</p>

<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>

<p>Purified recombinant EAF1 protein (His tag)</p>

<p>Armenian Hamster monoclonal FceRI alpha antibody (FITC)</p>

<p>The Glutamine Synthetase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in growth factor signaling, particularly in the regulation of alpha-fetoprotein and anti-VEGF pathways. This acidic antibody exhibits strong anticoagulation and antiangiogenic properties, making it an essential tool for studying endothelial growth and erythropoietin production.</p>

<p>Rabbit polyclonal TMEM176B antibody</p>

<p>TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH</p>

<p>Rabbit polyclonal TADA3 antibody (FITC)</p>

<p>Rabbit polyclonal NOS1 antibody</p>

<p>Protein S Antibody Pair for detection of Human Protein S in ELISA</p>

<p>MAP4K4 antibody was raised in Rabbit using Human MAP4K4 as the immunogen</p>

<p>The RBBP8 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ryanodine receptor, a protein involved in calcium release from intracellular stores. This antibody has been shown to neutralize the activity of the ryanodine receptor, preventing its interaction with other proteins and inhibiting its function. In addition, the RBBP8 antibody has reactive properties, allowing it to bind to specific acid residues on target proteins. This antibody has been used in studies investigating potassium channels, ischemia reperfusion injury, and neurokinin-1 receptor signaling. Its application in research has provided valuable insights into oxidative damage and ascorbic acid metabolism. The RBBP8 antibody is a powerful tool for scientists studying various biological processes and pathways.</p>

<p>DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD</p>

<p>CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH</p>

<p>RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.</p>

<p>The VEGFR3 antibody is a highly effective medicament that targets the glucan synthase and growth factor. It belongs to the class of Monoclonal Antibodies, which are known for their specificity and potency. This antibody specifically binds to epidermal growth factor (EGF) receptors on the apical membrane of cells, inhibiting their activation. By blocking the activity of EGF receptors, this monoclonal antibody prevents the binding of other cell antibodies and autoantibodies, thereby reducing inflammation and promoting healing. Additionally, studies have shown that the VEGFR3 antibody has antiviral properties and can help alleviate hepatic steatosis. With its wide range of applications in various pharmaceutical preparations, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant UQCRC1 protein (His tag)</p>

<p>Hsp40 antibody was raised in mouse using recombinant human Hsp40(1-340aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal ICT1 antibody</p>

<p>Cyclophilin B antibody was raised in mouse using recombinant human Cyclophilin B (26-216aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal PEBP1 antibody</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDL</p>

<p>MRPL11 antibody was raised in Rabbit using Human MRPL11 as the immunogen</p>

<p>The BAK antibody is a cytotoxic monoclonal antibody that targets specific proteins in the body. It has been shown to inhibit the activity of interleukin-6, fibronectin, and other growth factors. This antibody can be used in various research and diagnostic applications, including immunoassays and protein detection. It is commonly used in life sciences research, where it has been shown to have an impact on collagen synthesis, lipoprotein lipase activity, and retinoid metabolism. The BAK antibody is also used in the development of therapeutic drugs, such as adalimumab, and has been shown to promote hepatocyte growth. With its multidrug properties and wide range of applications, the BAK antibody is a valuable tool for researchers and scientists in various fields.</p>

<p>GPR124 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PPP2R5A antibody was raised using the N terminal of PPP2R5A corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW</p>

<p>The BRI3 antibody is a powerful tool in the field of Life Sciences. It is a steroid derivative that belongs to the class of monoclonal antibodies. This antibody specifically targets a molecule of interest, making it an essential tool for researchers studying various biological processes. The BRI3 antibody can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Purified synthetic Human BNP 32 protein</p>

<p>The POU5F1 antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It specifically targets the POU5F1 protein, also known as Oct-4, which plays a crucial role in maintaining pluripotency and self-renewal of embryonic stem cells. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Butyrophilin antibody was raised in mouse using Butyrophilin purified from bovine milk fat globule membrane as the immunogen.</p>

<p>Mouse monoclonal DNAJB1 antibody</p>

<p>LOC645015 antibody was raised using the middle region of LOC645015 corresponding to a region with amino acids LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD</p>