Produits biochimiques et réactifs

<p>Purified recombinant CXCL2 protein (Mouse) (His tag)</p>

<p>Haloperidol Conjugate for use in immunoassays</p>

<p>The HSV2 protein is a recombinant protein that falls under the category of Recombinant Proteins &amp; Antigens. It is a mitogen-activated protein that activates protein tyrosine kinases in various cellular processes. This protein has been extensively studied and is commonly used in research laboratories and life sciences.</p>

<p>Mouse monoclonal C15orf40 antibody</p>

<p>FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ</p>

<p>Hdac3 antibody was raised in rabbit using the C terminal of Hdac3 as the immunogen</p>

<p>SLC25A28 antibody was raised using the C terminal of SLC25A28 corresponding to a region with amino acids NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST</p>

<p>Purified recombinant RWDD4 protein (His tag)</p>

<p>CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal p300 antibody (Ser89)</p>

<p>Rabbit polyclonal TAF1B antibody</p>

<p>Rabbit polyclonal MYH14 antibody</p>

<p>The MAOA antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of the MAOA enzyme. This enzyme plays a crucial role in various physiological processes, including the regulation of lipoprotein lipase, interleukin-6, and adipose tissue metabolism. By inhibiting MAOA activity, this antibody has been shown to have significant effects on cellular processes such as fas-mediated apoptosis, phosphatase activity, actin filament organization, and erythropoietin signaling.</p>

<p>IVNS1ABP antibody was raised in Rabbit using Human IVNS1ABP as the immunogen</p>

<p>Rabbit polyclonal PKAR2 beta antibody (Ser113)</p>

<p>Mouse monoclonal CD199 antibody (FITC)</p>

<p>Rabbit polyclonal WRKY37 antibody</p>

<p>Hemoglobin A1c antibody is a monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to Hemoglobin A1c, a variant of hemoglobin that is formed when glucose binds to hemoglobin in the blood. This antibody can be used for various applications, including research and diagnostic purposes.</p>

<p>Rabbit polyclonal ADD1 antibody (Ser726)</p>

<p>The CD5 antibody is a monoclonal antibody that targets the CD5 protein isoforms. It contains disulfide bonds and has a reactive linker group that allows it to bind to specific protein-protein interactions. This antibody can be used in various applications in the field of life sciences, including the study of pluripotent cells, colony-stimulating factors, and growth factors. Additionally, the CD5 antibody has cytotoxic properties and can be utilized for targeted therapy against certain diseases. Its recombinant vaccinia formulation enhances its efficacy, making it an ideal choice for researchers and scientists working in the field of immunology and cell biology.</p>

<p>Recombinant Human ST6GAL1 protein (His tag)</p>

<p>The Cyclin D3 antibody is a highly specialized monoclonal antibody that targets the insulin growth factor pathway. It specifically binds to cyclin D3, a protein involved in cell cycle regulation and cell proliferation. By inhibiting the interaction between cyclin D3 and its receptors, this antibody effectively blocks the signaling pathway, preventing the growth and division of cancer cells.</p>

<p>Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Purified Polyclonal Carbonic Anhydrase 9 antibody</p>

<p>Rabbit polyclonal ZNF597 antibody</p>

<p>Rabbit polyclonal UNC13D antibody</p>

<p>The GLI2 antibody is a polyclonal antibody that specifically targets tyrosine residues in the GLI2 protein. It is commonly used in life sciences research for applications such as immunohistochemistry and Western blotting. This antibody has been shown to be effective in detecting GLI2 expression in various tissues and cell types. Additionally, it can be used to study the role of GLI2 in different biological processes, including insulin signaling and the activation of TRPV4. The GLI2 antibody is a valuable tool for researchers studying GLI2 function and its involvement in cellular processes. With its high specificity and sensitivity, this antibody provides reliable results for both basic research and clinical applications.</p>

<p>Purified recombinant PDZD11 protein (His tag)</p>

<p>GNAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF</p>

<p>Rabbit polyclonal GPR126 antibody</p>

<p>Mouse monoclonal ACY3 antibody</p>

<p>MAGEA8 antibody was raised in Rabbit using Human MAGEA8 as the immunogen</p>

<p>TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR</p>

<p>The IL8 antibody is a monoclonal antibody that specifically targets and binds to IL8, a growth factor involved in various biological processes. This antibody is widely used in life sciences research, particularly in bioassays and immunoassays to detect and quantify IL8 levels. It can also be used for therapeutic purposes, especially in the treatment of intraocular diseases associated with elevated IL8 levels.</p>

<p>The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.</p>

<p>Rabbit polyclonal SAMM50 antibody</p>

<p>LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE</p>

<p>CCDC28B antibody was raised in Rabbit using Human CCDC28B as the immunogen</p>

<p>FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>The BRAF antibody is a powerful tool used in Life Sciences research for the detection and analysis of specific proteins. This monoclonal antibody specifically targets the BRAF protein, which plays a crucial role in cell signaling pathways and is frequently mutated in various cancers. By binding to BRAF, this antibody allows researchers to study its expression, localization, and interactions with other molecules.</p>

<p>H6PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW</p>

<p>FSH beta antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Purified recombinant NT5E protein (His tag)</p>

<p>TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT</p>

<p>Mouse monoclonal CD45.1 antibody (biotin)</p>

<p>GLUT2 antibody was raised in rabbit using a 16 amino acid peptide from rat Glut-2 as the immunogen.</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>Purified Rabbit polyclonal HIRA antibody (Thr555)</p>

<p>SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS</p>

<p>The FAM84B antibody is a monoclonal antibody that targets the FAM84B protein. This protein plays a crucial role in various biological processes, including fatty acid metabolism and cell growth. The FAM84B antibody specifically binds to the FAM84B protein, allowing for its detection and analysis in various research applications.</p>

<p>Rabbit polyclonal APP antibody (HRP)</p>

<p>USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD</p>

<p>Rabbit polyclonal SDP3 antibody (FITC)</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>AVPV1a antibody was raised in rabbit using 19aa peptide of rat AVP-VIa receptor. as the immunogen.</p>

<p>1-328 amino acids: MGSSHHHHHH SSGLVPRGSH MSMLAERRRK QKWAVDPQNT AWSNDDSKFG QRMLEKMGWS KGKGLGAQEH GATDHIKVQV KNNHLGLGAT INNEDNWIAH QDDFNQLLAE LNTCHGQETT DSSDKKEKKS FSLEEKSKIS KNRVHYMKFT KGKDLSSRSK TDLDCIFGKR QSKKTPEGDA SPSTPEENET TTTSAFTIQE YFAKRMAALK NKPQVPVPGS DISETQVERK RGKKINKEAT GKDVESYLQP KAKRHTEGKP ERAEAQERVA KKKSAPAEEQ LRGPCWDQSS KASAQDAGDH VQPPEGRDFT LKPKKRRGKK KLQKPVEIAE DATLEETLVK KKKKKDSK</p>

<p>The BIRC3 antibody is a growth factor that belongs to the family of antibodies. It has been shown to be effective in human serum, specifically targeting alpha-fetoprotein and anti-mesothelin. This antibody can also bind to nuclear proteins and activate specific pathways related to cell growth and survival. The BIRC3 antibody is a monoclonal antibody, meaning it is highly specific and targeted. It has been used in various life sciences applications, including the study of fibrinogen, chemokines, and the neutralization of CD33 antibodies. Its versatility and effectiveness make it a valuable tool for researchers in the field.</p>

<p>Rabbit polyclonal TUBGCP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STK16 antibody, catalog no. 70R-3483</p>

<p>The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.</p>

<p>The PDLIM2 antibody is a powerful tool in the field of life sciences. This monoclonal antibody targets PDLIM2, a protein that plays a crucial role in various cellular processes. It has been observed that low levels of PDLIM2 are associated with dopamine dysregulation and may contribute to certain neurological disorders.</p>

<p>Rabbit Polyclonal TISB antibody</p>

<p>Rabbit polyclonal SLC17A1 antibody</p>

<p>The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.</p>

<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>

<p>Rabbit polyclonal Transaldolase antibody (FITC)</p>

<p>TRIM56 antibody was raised in rabbit using the middle region of TRIM56 as the immunogen</p>

<p>Mouse monoclonal ITM2B antibody</p>

<p>CDK5RAP1 antibody was raised using the N terminal of CDK5RAP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE</p>

<p>The Doublecortin antibody is a monoclonal antibody that targets the protein doublecortin, which is involved in the development of nerve cells. This antibody has been widely used in neuroscience research to study neurogenesis and neuronal migration. It has also been used to detect doublecortin expression in various tissues, including brain tissue and tumor samples. The Doublecortin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific experiments. With its high specificity and sensitivity, this antibody is an essential tool for investigating the role of doublecortin in various biological processes.</p>

<p>The VDAC2 antibody is a highly specific monoclonal antibody that targets the voltage-dependent anion channel 2 (VDAC2). This antibody is widely used in the field of life sciences for various applications. It has been shown to be effective in detecting and quantifying VDAC2 protein levels in different samples, including cell lysates and tissues.</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>The CENPH antibody is an acidic monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the role of GFAP in various cellular processes. This antibody can be used for immunohistochemistry, immunofluorescence, and western blotting applications. It has high specificity and sensitivity, making it a valuable tool for studying the expression and localization of GFAP in different tissues and cell types. The CENPH antibody can also be used in studies related to insulin signaling, transferrin uptake, glucose-6-phosphate metabolism, collagen synthesis, and antiphospholipid antibodies. With its reliable performance and wide range of applications, this antibody is a must-have for researchers in the field of life sciences.</p>

<p>NKp46 antibody was raised in mouse using recombinant human Nkp46 (22-255aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal SLC1A1 antibody</p>

<p>Rabbit polyclonal OR10J6 antibody</p>

<p>Chicken Red Blood Cells are widely used in the field of Life Sciences for various applications. They are commonly utilized in veterinary settings as an immune modulator and antimicrobial peptide. Chicken Red Blood Cells also serve as a diagnostic reagent, particularly in the detection of antibodies through techniques such as monoclonal antibody production and antibody-secreting cell assays. To obtain Chicken Red Blood Cells, sodium dodecyl sulfate or nonionic detergents can be used to induce cell lysis. Additionally, hydrochloric acid can be employed to further facilitate the lysis process. The resulting lysate can then be utilized for various downstream applications, including polymerase chain reactions (PCR) and other molecular biology techniques. Overall, Chicken Red Blood Cells offer a valuable resource for researchers and veterinarians alike, providing essential tools for immunological studies and diagnostic purposes. Their versatility and reliability make them an indispensable component in many scientific endeavors.</p>

<p>Cytokeratin 14 antibody was raised in guinea pig using recombinant human cytokeratin 14 as the immunogen.</p>

<p>Purified Polyclonal Kappa actin antibody</p>

<p>Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV</p>

<p>Mouse monoclonal anti human PDCL3 antibody</p>

<p>The IKB alpha antibody is a receptor-binding monoclonal antibody that targets the IKB alpha protein. It is commonly used in research and diagnostic applications to detect and quantify the levels of IKB alpha in various samples. The IKB alpha protein plays a crucial role in regulating the activity of NF-kappaB, a transcription factor involved in immune response and inflammation. By specifically binding to IKB alpha, this antibody can help researchers study the mechanisms underlying NF-kappaB activation and its downstream effects. Additionally, the IKB alpha antibody can be used as a tool for therapeutic purposes, such as blocking the interaction between IKB alpha and other binding proteins or autoantibodies. Its versatility makes it an essential tool for studying various biological processes and developing potential inhibitors for diseases associated with NF-kappaB dysregulation, such as autoimmune disorders or certain types of cancer.</p>

<p>Rat monoclonal Galectin 3 antibody (PE)</p>

<p>SCGB2A2 antibody was raised in Mouse using a purified recombinant fragment of human SCGB2A2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PKC mu antibody</p>

<p>ZNF136 antibody was raised in mouse using recombinant Zinc Finger Protein 136</p>

<p>TMB Substrate is a versatile product widely used in Life Sciences research. It is commonly utilized in various applications such as immunoassays and ELISA (enzyme-linked immunosorbent assay). TMB Substrate contains cefotiam, streptavidin, and monoclonal antibodies that enable accurate detection of specific targets. The substrate is activated by sodium carbonate and can be easily visualized with the addition of anhydrous sodium and hydrochloric acid. TMB Substrate also includes diluents, blockers, and assay reagents to optimize performance. It is compatible with human serum samples and can be used to measure chemokine levels or assess the activity of antibiotics like ceftriaxone and cefmetazole. Trust TMB Substrate for reliable and precise results in your scientific experiments.</p>

<p>TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN</p>

<p>Recombinant Human DBH protein (His tag)</p>

<p>OR2L3 antibody was raised in rabbit using the C terminal of OR2L3 as the immunogen</p>

<p>Mouse monoclonal VWA5A antibody</p>

<p>GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST</p>

<p>SLC25A32 antibody was raised using the middle region of SLC25A32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID</p>

<p>The CREB antibody is a highly effective tool for various applications in the field of Life Sciences. This polyclonal antibody is specifically designed to recognize and bind to the cAMP response element-binding protein (CREB), a transcription factor involved in regulating gene expression.</p>

<p>The TP53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the TP53 protein complex, which plays a crucial role in cell growth and apoptosis. This antibody has been extensively studied and has shown promising results in various research applications.</p>

<p>POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL</p>