Produits biochimiques et réactifs

<p>AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA</p>

<p>RHOF antibody was raised using a synthetic peptide corresponding to a region with amino acids DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM</p>

<p>Rat monoclonal CD71 antibody (PE)</p>

<p>Rabbit polyclonal RPLP0 antibody</p>

<p>The GALE antibody is a monoclonal antibody that targets the glycoprotein GALE. This powerful antibody has been developed for various applications in the field of Life Sciences. It specifically recognizes and binds to the glycan structures on GALE, providing a valuable tool for researchers studying glycan-related processes.</p>

<p>IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC</p>

<p>CNTN4 antibody is a highly specialized antibody that is used in the field of Life Sciences for various applications. It is a polyclonal antibody that specifically targets CNTN4, which is a protein involved in cell adhesion and signal transduction. This antibody can be used in research studies to investigate the role of CNTN4 in different biological processes, such as insulin signaling, annexin regulation, glucagon production, and alpha-fetoprotein expression. CNTN4 antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNTN4 protein in human serum and tissue samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. The use of CNTN4 antibody can help elucidate the mechanisms underlying various physiological and pathological processes and contribute to advancements in biomedical research.</p>

<p>Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.</p>

<p>293-431 amino acids: MSTGSKQRSQ NRSKTPKNQE ALRMANVAEN SSSDQRQACK KHELYVSFRD LGWQDWIIAP EGYAAYYCEG ECAFPLNSYM NATNHAIVQT LVHFINPETV PKPCCAPTQL NAISVLYFDD SSNVILKKYR NMVVRACGCH LEHHHHHH</p>

<p>Purified recombinant CLPS protein (His tag)</p>

<p>Hydrocodone 6 Conjugate for use in immunoassays</p>

<p>Highly purified Human CA 72-4 protein</p>

<p>Cefuroxime Axetil (USP grade powder) chemical reference substance</p>

<p>The POU4F3 antibody is a highly specialized monoclonal antibody that has various applications in the field of neurology and virology. It has been shown to have neuroprotective properties, making it a valuable tool for studying neurological disorders and potential therapeutic interventions. Additionally, this antibody exhibits antiviral activity by interfering with viral replication processes.</p>

<p>KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT</p>

<p>Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN</p>

<p>Rabbit polyclonal MRPL9 antibody (FITC)</p>

<p>Rabbit polyclonal Angiogenin antibody (FITC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied and proven to have high human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal Mouse anti Human Kappa Light Chain antibody</p>

<p>GINS3 antibody was raised in Rabbit using Human GINS3 as the immunogen</p>

<p>The ALK antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to ALK (anaplastic lymphoma kinase), a protein that plays a crucial role in cell growth and division. By binding to ALK, this antibody can help researchers study its function and investigate its involvement in various diseases.</p>

<p>The CLPP antibody is a highly specialized biomolecule that belongs to the class of monoclonal antibodies. It specifically targets chemokine binding proteins and has been widely used in life sciences research. This monoclonal antibody has a high affinity for its target and can be used for various applications, including immunoassays, protein detection, and cell signaling studies. The CLPP antibody has been shown to have cytotoxic effects on activated cells and can be used as a tool for targeted therapy. It can also be immobilized on electrodes or collagen matrices for use in biosensors or tissue engineering applications. With its exceptional specificity and versatility, the CLPP antibody is an invaluable tool in the field of molecular biology and biomedical research.</p>

<p>MLF2 antibody was raised in Rabbit using Human MLF2 as the immunogen</p>

<p>The eNOS antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied and proven to have significant cation binding properties. Through molecular docking, it has shown a strong affinity for epidermal growth factor (EGF), making it an essential tool for researchers studying EGF-related pathways.</p>

<p>Recombinant Human LAP3 protein (His tag)</p>

<p>GPR44 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SSE15206 is a chemical compound commonly referred to as an intermediate in organic synthesis. It is derived from complex chemical precursors through an extensive series of reactions involving catalysts and controlled conditions. This compound serves a pivotal role in the synthetic pathway by enabling the construction of more intricate molecules.</p>

<p>SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.</p>

<p>The F3 antibody is a potent cytotoxic and inhibitory factor used in Life Sciences. It targets various proteins and molecules such as tyrosinase, insulin, collagen, and fibronectin. This antibody has been extensively studied for its ability to neutralize autoantibodies and anti-ACTH antibodies. The F3 antibody is highly specific and can be used in a wide range of applications including research, diagnostics, and therapeutics. Its unique properties make it an essential tool for studying protein-protein interactions, cell signaling pathways, and immune responses. With its high affinity and specificity, the F3 antibody offers researchers unparalleled accuracy and reliability in their experiments.</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>The PYCR2 protein is a growth factor that plays a crucial role in neutralizing interferon. It is widely used in the field of Life Sciences for various applications. PYCR2 protein has been extensively studied and its binding proteins are well characterized. It is commonly used as a target for antibody-drug conjugates, monoclonal antibodies, and other therapeutic agents. PYCR2 protein is often purified from liver microsomes and can be used in research studies to investigate its interaction with other molecules such as globulins, chemokines, and anti-CD20 antibodies. This highly purified protein is free from any excipients and has a high refractive index, making it ideal for use in experiments requiring precise measurements.</p>

<p>Rat monoclonal Flk 1 antibody (allophycocyanin)</p>

<p>TRF3 antibody was raised in rabbit using the N terminal of TRF3 as the immunogen</p>

<p>The NRF2 antibody is a highly effective tool in the field of immunology and molecular biology. This antibody belongs to the class of polyclonal antibodies, which are produced by multiple B cell clones and have the ability to recognize different epitopes on the target protein. The NRF2 antibody specifically targets the nuclear factor erythroid 2-related factor 2 (NRF2), a transcription factor that plays a crucial role in cellular defense against oxidative stress.</p>

<p>Complement C3 protein is a test compound that plays a crucial role in the immune system. It is involved in various processes such as inflammation, opsonization, and immune complex clearance. Complement C3 protein interacts with IFN-gamma and is found to have intraocular effects. This protein is commonly used in research and diagnostic applications in the field of Life Sciences. It has been shown to exhibit neutralizing properties against autoantibodies and can be used for studying interferon and chemokine signaling pathways. Additionally, complement C3 protein has been implicated in endothelial growth factor regulation, making it an important target for therapeutic interventions related to angiogenesis. Its high viscosity allows for easy handling during experiments.</p>

<p>The CYP19 antibody is a highly specialized antibody that targets the aromatase enzyme, also known as cytochrome P450 19A1. This enzyme plays a crucial role in the synthesis of estrogen, making it an important target in hormone-related diseases and conditions. The CYP19 antibody specifically binds to the aromatase enzyme, inhibiting its activity and preventing the conversion of androgens into estrogens. This can have significant therapeutic implications in the treatment of hormone-dependent cancers such as breast cancer. Additionally, the CYP19 antibody has been used in research settings to study the regulation of estrogen synthesis and its impact on various physiological processes. With its high specificity and affinity for the aromatase enzyme, the CYP19 antibody is a valuable tool for both clinical and scientific applications in the field of endocrinology and oncology.</p>

<p>LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL31 antibody, catalog no. 70R-6296</p>

<p>FOXA1 antibody is a monoclonal antibody that specifically targets β-catenin, a protein involved in various cellular processes. This antibody acts as a family kinase inhibitor, blocking the activity of kinases that regulate β-catenin signaling. It is widely used in life sciences research to study the role of β-catenin in development, cancer, and other diseases.</p>

<p>ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA</p>

<p>Beta galactosidase antibody was raised in rabbit using beta galactosidase (E. Coli) as the immunogen.</p>

<p>BTF3L1 antibody was raised in rabbit using the n terminal of BTF3L1 as the immunogen</p>

<p>Purified Rabbit polyclonal LETMD1 antibody</p>

<p>PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL</p>

<p>NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Studies have shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>KIF5A antibody was raised using the middle region of KIF5A corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH</p>

<p>FABP3 protein is a growth factor that plays a crucial role in various biological processes. It can be activated by specific antibodies present in human serum, leading to the promotion of anti-angiogenesis activities. FABP3 is a glycoprotein that binds to fatty acids and facilitates their transport within cells. This protein can be detected using streptavidin-coated electrodes or colloidal gold-labeled antibodies. FABP3 is widely used in Life Sciences research as a target for studying cellular metabolism and lipid signaling pathways. Additionally, it serves as a valuable tool for developing inhibitors and monoclonal antibodies for therapeutic applications.</p>

<p>Purified recombinant ASPHD1 protein (His tag)</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR</p>

<p>Ciita antibody was raised in rabbit using CIITA peptide corresponding to a region near the N-terminus of the human protein conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal TPPP antibody</p>

<p>FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL</p>

<p>Portion of Influenza A</p>

<p>Rabbit polyclonal SPTAN1 antibody</p>

<p>The GPT Antibody is a polyclonal antibody that is commonly used in immunohistochemistry studies. It is an essential tool in the field of life sciences for detecting and analyzing various proteins and antigens. This antibody specifically targets the GPT protein, which is involved in numerous biological processes, including interferon signaling and chemokine binding.</p>

<p>The IGF1R antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the insulin-like growth factor 1 receptor (IGF1R) and has been shown to have cytotoxic effects on various types of cancer cells. This antibody can neutralize the activity of IGF1R, which is a key regulator of cell growth and proliferation. Additionally, it has been found to inhibit the expression of alpha-fetoprotein, a marker associated with liver cancer. The IGF1R antibody can also be used as an anti-connexin agent, blocking gap junction-mediated intercellular communication. In addition to its role in cancer research, this antibody has applications in studying adipose tissue development, endothelial growth factors, and nuclear signaling pathways.</p>

<p>CAV1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPLP0 antibody, catalog no. 70R-4936</p>

<p>LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL</p>

<p>SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA</p>

<p>Rabbit polyclonal ALK antibody (Tyr1507)</p>

<p>SUPT16H antibody was raised in rabbit using the N terminal of SUPT16H as the immunogen</p>

<p>Purified Polyclonal ATP8 antibody</p>

<p>Mouse monoclonal KRT18 antibody</p>

<p>Rabbit polyclonal SH3BP1 antibody</p>

<p>The GUF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the apical membrane of cells, allowing for precise detection and analysis. This antibody recognizes and interacts with specific tyrosine residues on growth factor receptors, providing valuable insights into signaling pathways and cellular responses.</p>

<p>AXUD1 antibody was raised in rabbit using human AXUD1 protein as the immunogen.</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>The Caspase 9 antibody is a highly specialized polyclonal antibody that targets the caspase 9 enzyme involved in apoptosis. It plays a crucial role in regulating cell death and is essential for maintaining tissue homeostasis. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research areas.</p>

<p>Rabbit polyclonal UPF3A antibody</p>

<p>The REN antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor and chemokine receptor CXCR4. It acts as a potent family kinase inhibitor, blocking the signaling pathways involved in cell growth and migration. This colloidal antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to have nephrotoxic effects, making it a potential therapeutic option for kidney-related disorders. The REN antibody is also used in research settings to detect autoantibodies and cytotoxic antibodies, as well as for studying thrombocytopenia. With its diverse applications and high efficacy, this antibody is an invaluable tool for scientists and researchers in various fields of study.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>Rabbit polyclonal HMMR antibody</p>

<p>The PDLIM2 antibody is a highly specific monoclonal antibody that is used in various life science assays. It is designed to detect and bind to the PDLIM2 protein, which plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. This antibody has been extensively validated for its high affinity and specificity, making it an ideal tool for researchers studying the function of PDLIM2 in different biological systems.</p>

<p>HSPA1A antibody was raised in Rabbit using Human HSPA1A as the immunogen</p>

<p>Rabbit polyclonal UGT8 antibody</p>

<p>NPFF2 antibody was raised in rabbit using N terminal sequence MNEKWDTNSSENWHPI and C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein as the immunogen.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Armenian Hamster monoclonal CD61 antibody (FITC)</p>

<p>KLK11 antibody was raised in rabbit using residues 68-82 [YIVHLGQHNLQKEEG] of the 35 kDa human hippostasin/KLK11protein as the immunogen.</p>

<p>ZMYND11 antibody was raised in rabbit using the N terminal of ZMYND11 as the immunogen</p>

<p>1-207 amino acids: MGSSHHHHHH SSGLVPRGSH MDKDCEMKRT TLDSPLGKLE LSGCEQGLHE IKLLGKGTSA ADAVEVPAPA AVLGGPEPLM QCTAWLNAYF HQPEAIEEFP VPAFHHPVFQ QESFTRQVLW KLLKVVKFGE VISYQQLAAL AGNPKAARAV GGAMRGNPVP ILIPCHRVVC SSGAVGNYSG GLAVKEWLLA HEGHRLGKPG LGGSSGLAGA WLKGAGATSG SPPAGRN</p>

<p>Hexokinase antibody was raised in mouse using recombinant human Hexokinase1 (1-917aa) purified from E. coli as the immunogen.</p>

<p>Digitoxin antibody was raised in rabbit using digitoxin-BSA as the immunogen.</p>

<p>ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.</p>

<p>Rabbit polyclonal KRBP antibody</p>

<p>Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA</p>

<p>The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.</p>

<p>1-162 amino acids: MGSSHHHHHH SSGLVPRGSH MPRADCIMRH LPYFCRGQVV RGFGRGSKQL GIPTANFPEQ VVDNLPADIS TGIYYGWASV GSGDVHKMVV SIGWNPYYKN TKKSMETHIM HTFKEDFYGE ILNVAIVGYL RPEKNFDSLE SLISAIQGDI EEAKKRLELP EHLKIKEDNF FQVSKSKIMN GH</p>

<p>RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF</p>

<p>LYZ antibody was raised in Rabbit using Human LYZ as the immunogen</p>

<p>Rabbit polyclonal Ret antibody (Tyr1062)</p>

<p>CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD</p>

<p>Rat monoclonal CD4 antibody (allophycocyanin); IgG2b kappa; clone GK1.5</p>

<p>The TrkA antibody is a highly specialized protein complex that plays a crucial role in various Life Sciences research applications. It is commonly used as a tool for studying the functions and interactions of specific proteins, such as c-myc and alpha-fetoprotein. This antibody is widely recognized for its exceptional specificity and sensitivity, making it an ideal choice for researchers in the field.</p>

<p>STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA</p>

<p>TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM</p>