Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT19 antibody, catalog no. 70R-2947</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF365 antibody, catalog no. 20R-1067</p>

<p>IL2 antibody was raised in mouse using highly pure recombinant rat IL-2 as the immunogen.</p>

<p>Transferrin receptor antibody was raised in mouse using human soluble transferrin receptor as the immunogen.</p>

<p>Rabbit polyclonal VEGFA antibody (FITC)</p>

<p>CFTR antibody was raised in rabbit using a synthetic peptide, G(103) R I I A S Y D P D N K E E R(117), as the immunogen.</p>

<p>The Alkaline Phosphatase antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to alkaline phosphatase, an enzyme that plays a crucial role in various biological processes. By targeting alkaline phosphatase, this antibody can be used to study its function and localization in different tissues and cell types.</p>

<p>Rabbit polyclonal DJ1 antibody (FITC)</p>

<p>MAPK6 antibody was raised in Rabbit using Human MAPK6 as the immunogen</p>

<p>Purified recombinant YOD1 protein (His tag)</p>

<p>PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV</p>

<p>JPH203 is a compound that has been shown to inhibit the growth of hypoxic tumor cells. It was found to induce apoptosis in tubule cells through a number of mechanisms, including the inhibition of cyclin D2 protein synthesis and the disruption of cellular signaling pathways. JPH203 is structurally similar to organic anion transporters (OATs), which are drug transporters in the body. This property may help it to cross the blood-brain barrier and reach tumors in the brain. JPH203 has also been shown to inhibit cancer cell proliferation and induce apoptosis in colorectal adenocarcinoma cells, as well as inhibiting tumor growth in animal models.</p>

<p>DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS</p>

<p>Rabbit polyclonal SRP9 antibody</p>

<p>The GOLM1 antibody is an active agent in the field of Life Sciences. It belongs to the class of antibodies and has shown promising results in various studies. This antibody specifically targets GOLM1, a glycoprotein that is involved in several cellular processes.</p>

<p>Rabbit polyclonal COX5B antibody</p>

<p>Purified recombinant MT3 protein (His tag)</p>

<p>The GAP43 antibody is a glycopeptide that acts as a neutralizing agent against phosphatase. It is commonly used in ophthalmic formulations and has shown efficacy in reducing inflammation caused by chemokines like TNF-α. This polyclonal antibody is widely used in life sciences research to study biomolecules, particularly in the field of antibodies. The GAP43 antibody has also been found to interact with epidermal growth factor, histidine, erythropoietin, and other growth factors. Additionally, it has been shown to affect microvessel density, making it a valuable tool for studying angiogenesis.</p>

<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA</p>

<p>Rabbit polyclonal SNF8 antibody</p>

<p>PSMD9 antibody was raised in rabbit using the middle region of PSMD9 as the immunogen</p>

<p>INF2 antibody was raised in Rabbit using Human INF2 as the immunogen</p>

<p>TNFRSF6B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to TNFRSF6B, a member of the tumor necrosis factor receptor superfamily. This antibody is widely used in various assays and experiments to study the role of TNFRSF6B in different biological processes.</p>

<p>Mouse monoclonal CD163 antibody (PE)</p>

<p>Rabbit polyclonal MSX2 antibody</p>

<p>MLF2 antibody was raised using the C terminal of MLF2 corresponding to a region with amino acids WRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRR</p>

<p>FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK</p>

<p>DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF</p>

<p>CYP4V2 antibody was raised using the middle region of CYP4V2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI</p>

<p>KLHL21 antibody was raised in Rabbit using Human KLHL21 as the immunogen</p>

<p>MOV10L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL</p>

<p>The CTNNB1 antibody is a monoclonal antibody that is used in immunochemical staining assays. It specifically targets the CTNNB1 protein, which plays a crucial role in pluripotent stem cell maintenance and differentiation. This antibody has a high molecular weight cut-off, allowing it to effectively detect and bind to the CTNNB1 protein in various biological samples. The CTNNB1 antibody can be used in a variety of applications, including Western blotting, immunohistochemistry, immunofluorescence, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it an ideal tool for researchers studying the function and expression of the CTNNB1 protein in different biological contexts. With its reliable performance and accurate results, the CTNNB1 antibody is an essential component for any laboratory conducting studies on pluripotent stem cells or related research areas.</p>

<p>Cdx1 antibody was raised in rabbit using the C terminal of Cdx1 as the immunogen</p>

<p>HHV6 gp60/gp100 antibody was raised in mouse using 60/110 KDa envelope glycoprotein of HHV6 as the immunogen.</p>

<p>C13ORF8 antibody was raised in rabbit using the middle region of C13ORF8 as the immunogen</p>

<p>EPM2A antibody was raised in mouse using recombinant human EPM2A (243-331aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal FSHB antibody</p>

<p>OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL</p>

<p>The GRK2 antibody is a monoclonal antibody that targets the G protein-coupled receptor kinase 2 (GRK2). This antibody has shown efficacy in neutralizing the effects of GRK2, which plays a crucial role in various cellular processes. It has been found to inhibit the activation of growth factors and mesenchymal stem cells, making it a potential therapeutic option for conditions related to abnormal cell growth. Additionally, the GRK2 antibody has been studied for its potential anticoagulant properties, as it can bind to fatty acids and antiphospholipid antibodies, reducing their plasma levels. This specific antibody shows promise in the field of Life Sciences and may have applications in treating conditions such as insulin resistance and complications associated with oral contraceptives.</p>

<p>LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN</p>

<p>Bovine Red Blood Cells are a vital component in the field of Life Sciences and have various applications, especially in Veterinary Applications. These cells can be used as a fluorophore for imaging studies and other research purposes. The emission properties of Bovine Red Blood Cells make them suitable for use in fluorescence-based assays.</p>

<p>High affinity probe for glucose transporter; photoaffinity label</p>

<p>Rabbit polyclonal LEF1 antibody (Ser42)</p>

<p>Purified recombinant NXPH1 protein (His tag)</p>

<p>HNRNPC antibody was raised in Rabbit using Human HNRNPC as the immunogen</p>

<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>

<p>CLAN antibody was raised in rabbit using N terminus sequence MNFIKDNSRA LIQRMGM of the A and B isoforms of the human CLAN protein as the immunogen.</p>

<p>Il6 protein is an inhibitory factor that belongs to the group of proteins and antigens. It can be used in combination with adalimumab or other inhibitors for therapeutic purposes. Il6 protein has been shown to have chemokine and epidermal growth factor properties, as well as anti-VEGF (vascular endothelial growth factor) and neutralizing effects on TNF-α (tumor necrosis factor-alpha). It also exhibits activity against interleukins and interferons. Additionally, Il6 protein has carbonic properties and can be used in conjugated proteins for various applications, including the treatment of endothelial growth disorders.</p>

<p>Purified Polyclonal EDG3 antibody</p>

<p>Recombinant Human PICK1 protein (His tag)</p>

<p>Purified recombinant GDI2 protein (His tag)</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFV</p>

<p>SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12</p>

<p>The Cytochrome P450 2D6 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize the activity of the Cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism and can affect the efficacy and safety of various medications.</p>

<p>MRPL28 antibody was raised in Rabbit using Human MRPL28 as the immunogen</p>

<p>Rabbit polyclonal SEC61A1 antibody</p>

<p>Rabbit Polyclonal OR2A7 antibody</p>

<p>ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV</p>

<p>AD80 is a multi-kinase inhibitor that prevents the phosphorylation and activation of tyrosine kinases. It has been shown to inhibit the proliferation of leukemia cells in vivo. AD80 has been found to be effective against glioblastoma cells and other cancer types, such as melanoma, breast cancer, and lung cancer. AD80 inhibits protein synthesis by binding to the ATP-binding site of the enzyme kinase domain. The solubility data for AD80 shows that it is highly soluble in water and organic solvents.</p>

<p>Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Purified Polyclonal CACNG1 antibody</p>

<p>BRCA2 (pSer3291)</p>

<p>Amyloid P-IN-1 is a ligand that binds to the amyloid peptide and inhibits the formation of amyloids. Amyloid P-IN-1 has been shown to be an orally active molecule in humans, with a low oral bioavailability due to its physicochemical properties. The affinity for amyloid P-IN-1 to bind to the amyloid peptide is high and it has been shown to inhibit the growth of amyloids in vitro and in vivo. Amyloid P-IN-1 also has pharmacological effects on ligands, such as binding to receptors on cells, which may account for its potential use as a therapeutic agent.</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR</p>

<p>WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids TKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQW</p>

<p>MSTN antibody was raised in Rabbit using Human MSTN as the immunogen</p>

<p>Rabbit polyclonal TPH2 antibody (Ser58)</p>

<p>Rabbit polyclonal VEGFC antibody (FITC)</p>

<p>LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS</p>

<p>Mouse monoclonal RIT2 antibody</p>

<p>The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.</p>

<p>The SYN1 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SYN1 antigen. This antibody has been extensively tested and proven to be effective in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA).</p>

<p>Mouse monoclonal Complement H antibody (Biotin)</p>

<p>Purified Polyclonal USP35 antibody</p>

<p>Apramycin Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal BCLW antibody</p>

<p>Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA</p>

<p>Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF</p>

<p>Mouse monoclonal p53 antibody (Prediluted for IHC)</p>

<p>Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>Rabbit polyclonal STRADB antibody</p>

<p>TECK antibody was raised in mouse using highly pure recombinant human TECK as the immunogen.</p>

<p>The BECN1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor-like domain of BECN1. It has been shown to neutralize the activity of TNF-α, a pro-inflammatory cytokine involved in various diseases. This specific antibody can inhibit the binding of TNF-α to its receptor and prevent downstream signaling pathways associated with inflammation. In addition, the BECN1 antibody has been found to block the interaction between growth factors and fibronectin, inhibiting cell migration and proliferation. It also shows potential in modulating chemokine expression and regulating TGF-beta signaling. With its wide range of applications in life sciences, this antibody holds promise for research and therapeutic purposes in collagen-related diseases and other inflammatory conditions.</p>

<p>CXCR4 antibody was raised in goat using YSEEVGSGDYDSNKEPCFRDENVHFNR corresponding to the N-terminal extracellular domain of mouse CXCR4 receptor.   as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.</p>

<p>Mouse monoclonal TFAP2C antibody</p>

<p>MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>Purified Polyclonal FOXC1/2 antibody</p>

<p>The IGJ antibody is a monoclonal antibody that specifically targets insulin in the human body. It is designed to bind to insulin molecules and prevent their interaction with insulin receptors, thereby inhibiting their activity. This antibody is commonly used in Life Sciences research to study the role of insulin in various physiological processes.</p>

<p>The Septin 9 antibody is a highly specialized monoclonal antibody that targets a specific cell antigen. It has been extensively studied in the field of pluripotent stem cells and has shown promising results in various applications. This antibody has been used in research studies involving the treatment of cancer with doxorubicin, as well as in polymerase chain reactions (PCR) to detect specific messenger RNA molecules.</p>

<p>Rabbit polyclonal WDR4 antibody</p>

<p>Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.</p>

<p>KCNJ16 antibody was raised using the middle region of KCNJ16 corresponding to a region with amino acids RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL</p>

<p>PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL</p>