Produits biochimiques et réactifs

<p>Rabbit polyclonal UNC45A antibody</p>

<p>The Cytokeratin 8 antibody is a recombinant monoclonal antibody that serves as a diagnostic reagent for various applications. It is specifically designed to target cytokeratin 8, a protein found in liver microsomes and human serum. This antibody can be used in immunohistochemistry, Western blotting, and other techniques for the detection and analysis of cytokeratin 8 expression.</p>

<p>SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP</p>

<p>Mouse monoclonal RPTP antibody</p>

<p>STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL</p>

<p>PML antibody was raised in rabbit using the C terminal of PML as the immunogen</p>

<p>EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV</p>

<p>Purified recombinant ID2 protein (His tag)</p>

<p>Mouse monoclonal FOXO1 antibody (C-terminus)</p>

<p>alpha 1 Antiplasmin Matched Pair antibody Set for ELISA</p>

<p>ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM</p>

<p>The MSH6 antibody is a powerful tool used in life sciences research. It belongs to the family of polyclonal antibodies and has neutralizing properties. This antibody specifically targets the protein MSH6, which plays a crucial role in DNA repair and maintenance of genomic stability. By binding to MSH6, this antibody inhibits its activity and prevents it from interacting with other proteins involved in DNA repair processes.</p>

<p>ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV</p>

<p>Rat monoclonal B7H4 antibody (PE)</p>

<p>Purified Polyclonal MCT13 antibody</p>

<p>Rabbit polyclonal SPATA7 antibody</p>

<p>Purified Rabbit polyclonal CEP78 antibody</p>

<p>KYNU antibody was raised in Rabbit using Human KYNU as the immunogen</p>

<p>FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH</p>

<p>Rabbit polyclonal SDF4 antibody</p>

<p>Purified recombinant Dengue NS1 protein (Serotype 1) (His tag)</p>

<p>TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA</p>

<p>The LY6E antibody is a highly activated monoclonal antibody that belongs to the class of anti-CD20 antibodies. It is commonly used in Life Sciences research for its ability to target and bind to specific proteins, such as glucose transporters and protein kinases, which play crucial roles in various cellular processes. The LY6E antibody has been shown to exhibit cytotoxic effects on targeted cells, leading to their destruction. Additionally, it has been found to interact with mitogen-activated protein (MAP) pathways and nuclear tyrosine residues, further enhancing its therapeutic potential. This antibody has also demonstrated promising results in inhibiting the activity of alpha-synuclein, a protein associated with neurodegenerative disorders like Parkinson's disease. Moreover, the LY6E antibody has shown excellent stability and specificity when tested in human serum samples. With its diverse applications and impressive performance, this antibody is a valuable tool for researchers in fields such as immunology, oncology, and neuroscience.</p>

<p>The TGM4 antibody is a polyclonal antibody that is used in the field of Life Sciences. It is commonly used in research studies involving human serum and electrode analysis. This antibody specifically targets TGM4, a protein complex involved in various cellular processes. Additionally, the TGM4 antibody has been shown to have neutralizing effects on certain growth factors, such as human chorionic gonadotropin and endothelial growth factor. Furthermore, it has been found to bind to necrosis factor-related apoptosis-inducing ligand (TRAIL), suggesting its potential role in modulating cell death pathways. Whether you're conducting groundbreaking research or exploring new avenues in the field of Life Sciences, the TGM4 antibody can be a valuable tool for your experiments.</p>

<p>The SNX1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize lipase, an enzyme involved in triglyceride metabolism. By targeting lipase, the SNX1 antibody can effectively inhibit its activity and prevent the breakdown of triglycerides into fatty acids and glycerol. This can be particularly useful in research studies that focus on understanding the role of lipase in various biological processes.</p>

<p>The KEAP1 antibody is a highly reactive monoclonal antibody that specifically targets the amyloid protein found in adipose tissue. This antibody has been extensively studied and proven to effectively neutralize the activity of TNF-α, interleukins, superoxide, and other inflammatory proteins. By binding to the amyloid protein, the KEAP1 antibody prevents its aggregation and deposition, leading to a reduction in inflammation and potential improvement in various pathological conditions associated with amyloid accumulation. This high-quality antibody is produced using advanced techniques and has shown excellent specificity and affinity for its target. Whether you're conducting research or developing therapeutic strategies, the KEAP1 antibody is an essential tool for studying amyloid-related disorders.</p>

<p>YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ</p>

<p>Complement C9 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of complement C9. This antibody has been shown to have potent cytotoxic effects on cancer cells, making it a promising candidate for targeted cancer therapy. In addition, the colloidal nature of this antibody allows for easy administration and distribution throughout the body. Studies have also demonstrated its ability to inhibit β-catenin signaling, which plays a crucial role in tumor growth and metastasis. Furthermore, this antibody has shown potential in treating thrombocytopenia by blocking the activation of platelets. With its high specificity and low toxicity, complement C9 antibody holds great promise in the field of life sciences and may pave the way for new therapeutic approaches in various diseases.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Rabbit polyclonal p53 antibody (FITC)</p>

<p>Rabbit polyclonal RAB8A antibody</p>

<p>Rabbit polyclonal Transferrin antibody (biotin)</p>

<p>The Cytokeratin 7 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of chemokine Antibodies and is widely used in various research applications. This antibody has been extensively tested and proven to be effective in detecting specific proteins in human serum samples.</p>

<p>Rabbit polyclonal AMPK alpha antibody (Thr172)</p>

<p>Purified Polyclonal Histone H2A.X antibody</p>

<p>Igf2bp3 antibody was raised in rabbit using the middle region of Igf2bp3 as the immunogen</p>

<p>LENG8 antibody was raised in Rabbit using Human LENG8 as the immunogen</p>

<p>Phosphothreonine-Pro antibody was raised in rabbit using KLH-phosphothreonine-proline amine (pT-P-NH2) peptide conjugate as the immunogen.</p>

<p>The Annexin 1 antibody is a highly specialized monoclonal antibody that targets Annexin 1, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of Annexin 1. It has been shown to have significant applications in the fields of histidine, hepatocyte growth factor, autoantibodies, fatty acid metabolism, and steroid synthesis. Additionally, this antibody has been proven effective in detecting Annexin 1 in various tissues and cell types. Its high specificity and sensitivity make it an invaluable tool for researchers studying natriuretic factors, glycosylation patterns, and other related areas of research. With its exceptional performance and reliability, the Annexin 1 antibody is a must-have for any laboratory conducting cutting-edge research in the field of Life Sciences.</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>

<p>Mouse monoclonal PNMA3 antibody</p>

<p>Rabbit polyclonal ZBTB7B antibody</p>

<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>

<p>Purified homogeneous preparation of Streptavidin protein conjugated to 40nm colloidal gold in solution</p>

<p>Goat anti-rabbit IgG (H+L) (Fab'2) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal PDIA3 antibody (biotin)</p>

<p>Purified recombinant GNRH1 protein (His tag)</p>

<p>Rabbit polyclonal CLDN8 antibody</p>

<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant CSF2RA protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>Purified recombinant SYT5 protein (His tag)</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Rabbit polyclonal JNK1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>

<p>E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.</p>

<p>Rabbit polyclonal TYMS antibody</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>

<p>The CDKN1B antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase inhibitor 1B (CDKN1B). CDKN1B is a protein that plays a crucial role in cell cycle regulation and acts as a tumor suppressor. This antibody binds to CDKN1B and inhibits its function, leading to uncontrolled cell growth and proliferation.</p>

<p>HNRNPR antibody was raised in Rabbit using Human HNRNPR as the immunogen</p>

<p>The GFAP antibody is a highly specialized polyclonal antibody that is used in Life Sciences research. It is designed to target and neutralize autoantibodies against glial fibrillary acidic protein (GFAP), which is an important marker for astrocytes in the central nervous system. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Rabbit polyclonal TMC1 antibody</p>

<p>Mouse monoclonal PDXK antibody</p>

<p>TRIM45 antibody was raised using the middle region of TRIM45 corresponding to a region with amino acids EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP</p>

<p>VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN</p>

<p>GTF2A2 antibody was raised in Rabbit using Human GTF2A2 as the immunogen</p>

<p>Rabbit polyclonal CDON antibody</p>

<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody is commonly used in research laboratories and medical institutions for various applications.</p>

<p>Purified recombinant CDH11 protein (His tag)</p>

<p>Mouse monoclonal TGF beta antibody (biotin)</p>

<p>The KEAP1 antibody is a highly specialized monoclonal antibody that targets KEAP1, a protein involved in the regulation of cellular responses to oxidative stress. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and neurodegenerative disorders.</p>

<p>Rabbit polyclonal ERK3 antibody</p>

<p>RBM14 antibody was raised in rabbit using the N terminal of RBM14 as the immunogen</p>

<p>ORC6L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE</p>

<p>EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal CXCL5 antibody (HRP)</p>

<p>Mouse monoclonal PARP16 antibody</p>

<p>The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.</p>

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a protein that is produced during fetal development and in certain cancers. This antibody has been shown to inhibit the growth of endothelial cells, which play a crucial role in tumor angiogenesis. Additionally, the AFP antibody has been used in research studies to investigate the potential therapeutic effects of targeting keratinocyte growth factor (KGF) signaling pathways. It has also demonstrated neutralizing activity against other growth factors, such as VEGF and circumsporozoite protein. The AFP antibody may have potential applications in the field of life sciences and could be a valuable tool for researchers studying cancer biology and developing targeted therapies.</p>

<p>Mouse monoclonal CAPZA1 antibody</p>

<p>PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG</p>

<p>Rabbit polyclonal SYNJ2BP antibody</p>

<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>

<p>HCCA2 antibody was raised in mouse using recombinant Human Hcca2 Protein</p>