Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.115 produits)
- Par Biological Target(99.074 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.219 produits)
130577 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SOCS7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOCS7 antibody, catalog no. 70R-5835</p>Degré de pureté :Min. 95%ELMOD1 antibody
<p>ELMOD1 antibody was raised in rabbit using the middle region of ELMOD1 as the immunogen</p>Degré de pureté :Min. 95%VPS4A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS4A antibody, catalog no. 70R-2376</p>Degré de pureté :Min. 95%LCMV antibody
<p>LCMV antibody was raised in mouse using LCMV isolated from human HeLa cells as the immunogen.</p>ALDH4A1 antibody
<p>ALDH4A1 antibody was raised using the C terminal of ALDH4A1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI</p>Clavulanate Lithium
<p>Clavulanate Lithium (USP grade powder) chemical reference substance</p>Degré de pureté :Min. 95%FIBCD1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FIBCD1 antibody, catalog no. 70R-6987</p>Degré de pureté :Min. 95%PROTAC cIAP1 degrader-4
CAS :<p>PROTAC cIAP1 degrader-4 is a peptide inhibitor of the protein IAP1. It is a recombinant fusion protein consisting of the C terminus of human caspase-recruitment domain (CARD) with the N terminus of mouse IgG2a Fc region. The CARD domain binds to and inhibits the activity of IAP1, which is an inhibitor of apoptosis. This product can be used as a research tool and antibody probe for studying protein interactions, ligands, receptors, ion channels, and other proteins in cell biology research.</p>Formule :C60H83N7O10Degré de pureté :Min. 95%Masse moléculaire :1,062.3 g/molPDGFRB antibody
<p>PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%IFI35 antibody
<p>IFI35 antibody was raised in mouse using recombinant Human Interferon-Induced Protein 35 (Ifi35)</p>PER2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PER2 antibody, catalog no. 70R-8370</p>Degré de pureté :Min. 95%NCAPH2 antibody
<p>NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE</p>ACADSB antibody
<p>ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG</p>VASP antibody
<p>The VASP antibody is a highly specific monoclonal antibody that can be used in various applications in the field of life sciences. This antibody specifically targets VASP (Vasodilator-Stimulated Phosphoprotein), a protein involved in cell signaling and cytoskeletal dynamics. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.</p>Rabbit κ light chain antibody (Prediluted for IHC)
<p>Rabbit polyclonal Kappa light chain antibody (Prediluted for IHC)</p>Degré de pureté :Min. 95%ZFP28 antibody
<p>ZFP28 antibody was raised in rabbit using the middle region of ZFP28 as the immunogen</p>Degré de pureté :Min. 95%Goat anti Human IgG (rhodamine)
<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>Degré de pureté :Min. 95%THAP1 antibody
<p>The THAP1 antibody is a polypeptide that exhibits strong antibody activity. It is a protein that specifically targets and binds to THAP1, a transcription factor associated with various biological processes in the cell. This antibody can be used in research, diagnostics, and therapeutics in the field of life sciences. Its high specificity and affinity make it a valuable tool for studying the function and regulation of THAP1, as well as its potential role in disease development. With its ability to recognize and bind to THAP1, this antibody enables researchers to investigate the impact of THAP1 on cellular processes and explore its therapeutic potential in various diseases.</p>BMP10 antibody
<p>The BMP10 antibody is a highly specialized product used in Life Sciences research. It is designed to target and bind to the BMP10 protein, which plays a crucial role in the development and function of neonatal cardiac myocytes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.</p>RPL6 antibody
<p>RPL6 antibody was raised using the N terminal of RPL6 corresponding to a region with amino acids AGEKVEKPDTKEKKPEAKKVDAGGKVKKGNLKAKKPKKGKPHCSRNPVLV</p>MYL2 antibody
<p>MYL2 antibody was raised in Mouse using a purified recombinant fragment of MYL2 expressed in E. coli as the immunogen.</p>DHCR24 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUSAP1 antibody, catalog no. 70R-2155</p>Degré de pureté :Min. 95%ICAM5 antibody
<p>ICAM5 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets ICAM5, which stands for intercellular adhesion molecule 5. ICAM5 plays a crucial role in cell adhesion and has been found to interact with various molecules such as fibrinogen, growth factors, histidine phosphatase, lipoprotein lipase, chemokines, and cytotoxic agents.</p>TOMM40L antibody
<p>TOMM40L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD</p>PTPN6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPN6 antibody, catalog no. 70R-10310</p>Degré de pureté :Min. 95%FGFR2 antibody
<p>The FGFR2 antibody is a highly effective multidrug that belongs to the class of monoclonal antibodies. It targets and binds to specific proteins such as alpha-fetoprotein, annexin A2, and growth factors. This cytotoxic antibody has been shown to have strong inhibitory effects on the growth of cancer cells. It can be used in various applications including research, diagnostics, and therapeutic treatments. The FGFR2 antibody is highly specific and exhibits excellent binding affinity to its target proteins. With its exceptional performance, this monoclonal antibody is a valuable tool for scientists and medical professionals working in the fields of oncology, immunology, and cell biology.</p>SLC25A24 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A24 antibody, catalog no. 70R-6468</p>Degré de pureté :Min. 95%KCNG4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNG4 antibody, catalog no. 70R-5178</p>Degré de pureté :Min. 95%IL15Ra antibody
<p>The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.</p>TIMP3 antibody
<p>The TIMP3 antibody is a monoclonal antibody that targets the tissue inhibitor of metalloproteinase 3 (TIMP3). TIMP3 plays a crucial role in regulating endothelial growth and inhibiting the activity of metalloproteinases, which are enzymes involved in tissue remodeling. This antibody specifically binds to TIMP3 and can be used for various research purposes in the field of life sciences.</p>MMP7 antibody
<p>MMP7 antibody was raised in mouse using human MMP-7 from rectal carcinoma as the immunogen.</p>RBBP4 antibody
<p>The RBBP4 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the RBBP4 protein, which plays a crucial role in various cellular processes. This antibody has been shown to bind to albumin and activate it, leading to changes in human serum composition. Additionally, it has been found to interact with alpha-synuclein, a protein associated with neurodegenerative diseases.</p>YWHAH antibody
<p>YWHAH antibody was raised in rabbit using the N terminal of YWHAH as the immunogen</p>ARAP1 antibody
<p>The ARAP1 antibody is a highly specific monoclonal antibody that targets tumor necrosis factor-alpha (TNF-α). It is commonly used in Life Sciences research to study the role of TNF-α in various biological processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and ELISA.</p>WFDC1 antibody
<p>The WFDC1 antibody is a highly specialized monoclonal antibody that is used in biochemical and life sciences research. It specifically targets the growth factor WFDC1, which has been shown to play a significant role in various cellular processes, including cell adhesion and migration.</p>GNB1L antibody
<p>GNB1L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA</p>TRPC6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPC6 antibody, catalog no. 70R-5132</p>Degré de pureté :Min. 95%TNIP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNIP1 antibody, catalog no. 70R-10358</p>Degré de pureté :Min. 95%LDLRAD1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LDLRAD1 antibody, catalog no. 70R-6670</p>Degré de pureté :Min. 95%COMMD8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COMMD8 antibody, catalog no. 70R-9469</p>Degré de pureté :Min. 95%ZNF548 antibody
<p>ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen</p>Degré de pureté :Min. 95%OR2K2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2K2 antibody, catalog no. 70R-9866</p>Degré de pureté :Min. 95%SLCO3A1 antibody
<p>SLCO3A1 antibody was raised using the middle region of SLCO3A1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL</p>Degré de pureté :Min. 95%MUTYH antibody
<p>The MUTYH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the MUTYH protein, which plays a crucial role in DNA repair. This antibody can be used to study the function and expression of MUTYH in various biological processes. Additionally, it has been shown to interact with growth factors, calmodulin, superoxide, steroids, and other antibodies. The MUTYH antibody is highly specific and sensitive, making it a valuable tool for researchers studying DNA repair mechanisms and related pathways. With its ability to detect and quantify MUTYH protein levels, this antibody is an essential component in understanding the intricate workings of cellular processes.</p>Degré de pureté :Min. 95%MMP2 Proenzyme protein
<p>Purified recombinant Human MMP2 Proenzyme protein</p>Degré de pureté :Min. 95%PEX11A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PEX11A antibody, catalog no. 70R-6611</p>Degré de pureté :Min. 95%RALY Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RALY antibody, catalog no. 70R-2071</p>Degré de pureté :Min. 95%TMPRSS5 antibody
<p>TMPRSS5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN</p>Degré de pureté :Min. 95%Kanamycin monoclonal antibody
<p>The Kanamycin monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets kinase m2, a protein involved in various cellular processes. It has been extensively used for research purposes, particularly in studies related to histone h1 and mitogen-activated protein. The Kanamycin monoclonal antibody has also shown promising results in the treatment of certain medical conditions, such as ischemia reperfusion injury. Its unique binding properties make it an ideal candidate for applications such as fluorescence immunochromatography. With its high specificity and affinity, this antibody offers great potential for advancements in the field of medicine and research.</p>Goat anti Syrian Hamster IgG (H + L) (rhodamine)
<p>Goat anti-syrian Hamster IgG (H + L) (rhodamine) was raised in goat using hamster IgG (H & L) as the immunogen.</p>Apolipoprotein C2 antibody
<p>The Apolipoprotein C2 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and inhibits the function of apolipoprotein C2, a protein involved in lipid metabolism. By blocking the activity of apolipoprotein C2, this antibody can be used to study its role in various biological processes.</p>PYGB antibody
<p>PYGB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%MAB21L1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAB21L1 antibody, catalog no. 70R-3048</p>Degré de pureté :Min. 95%LCA5 antibody
<p>LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST</p>PRPF19 antibody
<p>PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP</p>TGIF1 antibody
<p>TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN</p>SOX17 antibody
<p>SOX17 antibody was raised in rabbit using the middle region of SOX17 as the immunogen</p>Degré de pureté :Min. 95%
