Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.104 produits)
- Par Biological Target(99.074 produits)
- Par usage/effets pharmacologiques(6.784 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.218 produits)
130576 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SUZ12 antibody
<p>The SUZ12 antibody is a highly effective antiviral agent that belongs to the class of inhibitors in Life Sciences. It has been extensively studied for its ability to target specific growth factors and human serum components, making it a valuable tool in the field of virology. This low-molecular-weight antibody has shown promising results in treating thrombocytopenia, a condition characterized by low platelet count. Additionally, it has been found to possess neutralizing properties against influenza hemagglutinin, making it an ideal candidate for developing antiviral therapies. The SUZ12 antibody can be immobilized on electrodes for use in various applications, and its high specificity makes it an excellent choice for monoclonal antibody-based diagnostics and research.</p>PCDHA5 antibody
<p>PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL</p>Degré de pureté :Min. 95%AARS antibody
<p>AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP</p>NGAL antibody
<p>The NGAL antibody is a specific antibody that targets the epidermal growth factor (EGF) and tumor necrosis factor-alpha (TNF-α). It falls under the category of Life Sciences and Monoclonal Antibodies. This antibody has been shown to have neutralizing effects on autoantibodies and growth factors such as collagen, transforming growth factor-beta (TGF-beta), and fibronectin. By targeting these factors, the NGAL antibody can help regulate cell signaling pathways and inhibit abnormal cell growth. Additionally, this antibody has been found to be effective in blocking the activation of chemokines, which play a crucial role in inflammation and immune response. With its high specificity and neutralizing properties, the NGAL antibody holds great potential for therapeutic applications in various fields of research and medicine.</p>GnRHR antibody
<p>GnRHR antibody was raised in mouse using highly pure human gonadotropin releasing hormone receptor as the immunogen.</p>PPP1R3A antibody
<p>PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE</p>Degré de pureté :Min. 95%KRT8 antibody
<p>The KRT8 antibody is a highly specialized monoclonal antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine, a neurotransmitter with cholinergic properties. The KRT8 antibody has been extensively tested and validated for its specificity and sensitivity in detecting choline acetyltransferase in human serum samples.</p>NGAL antibody
<p>The NGAL antibody is a monoclonal antibody that is commonly used in scientific research and medical diagnostics. It is designed to specifically bind to neutrophil gelatinase-associated lipocalin (NGAL), an anti-apoptotic protein that is involved in various physiological processes.</p>Cytokeratin 18 antibody
<p>The Cytokeratin 18 antibody is a highly activated monoclonal antibody that specifically targets cytokeratin 18, a protein found in human serum. This antibody is cationic in nature and has been extensively studied for its ability to bind to cytokeratin 18 and induce cytotoxic effects. It has been used in various research applications, including immunohistochemistry and western blotting, to detect the presence of cytokeratin 18 in different tissues and cell types.</p>Degré de pureté :Min. 95%BRDT antibody
<p>BRDT antibody was raised in rabbit using the N terminal of BRDT as the immunogen</p>Degré de pureté :Min. 95%NGAL antibody
<p>The NGAL antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important biomarker for various diseases, including helicobacter infection and kidney injury. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA. Its high specificity and affinity make it an ideal choice for researchers studying the role of NGAL in disease progression and therapeutic interventions. With its ability to bind to NGAL with high precision, this antibody opens up new possibilities for understanding the complex mechanisms underlying chemokine signaling and endothelial growth factor regulation. Whether you are working in academia or industry, the NGAL antibody will undoubtedly enhance your research capabilities and contribute to advancements in the field.</p>DHX35 antibody
<p>DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ</p>RBBP7 antibody
<p>The RBBP7 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor and has been extensively used in various applications such as immunoassays, immunofluorescence, and Western blotting. This antibody has shown high affinity and specificity for its target, making it an essential tool for studying cellular processes involving the epidermal growth factor pathway.</p>TREML2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TREML2 antibody, catalog no. 70R-6395</p>Degré de pureté :Min. 95%Phosphothreonine-Pro antibody
<p>Phosphothreonine-Pro antibody was raised in rabbit using KLH-phosphothreonine-proline amine (pT-P-NH2) peptide conjugate as the immunogen.</p>Degré de pureté :Min. 95%Annexin 1 antibody
<p>The Annexin 1 antibody is a highly specialized monoclonal antibody that targets Annexin 1, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of Annexin 1. It has been shown to have significant applications in the fields of histidine, hepatocyte growth factor, autoantibodies, fatty acid metabolism, and steroid synthesis. Additionally, this antibody has been proven effective in detecting Annexin 1 in various tissues and cell types. Its high specificity and sensitivity make it an invaluable tool for researchers studying natriuretic factors, glycosylation patterns, and other related areas of research. With its exceptional performance and reliability, the Annexin 1 antibody is a must-have for any laboratory conducting cutting-edge research in the field of Life Sciences.</p>AChE antibody
<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>Degré de pureté :Min. 95%Goat anti Human IgG (biotin)
<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>Degré de pureté :Min. 95%TRIM14 antibody
<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>LRRC8B antibody
<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>Degré de pureté :Min. 95%Streptavidin (40nm Gold Colloid)
<p>Purified homogeneous preparation of Streptavidin protein conjugated to 40nm colloidal gold in solution</p>Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (Fab'2) (FITC)
<p>Goat anti-rabbit IgG (H+L) (Fab'2) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%VEGFR1 antibody
<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>Fibrinogen antibody
<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>CSF2RA protein (His tag)
<p>Purified recombinant CSF2RA protein (His tag)</p>Degré de pureté :Min. 95%SPARCL1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>ME3 antibody
<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>CRTAP antibody
<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>Degré de pureté :Min. 95%HP antibody
<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>ACAA1 antibody
<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>Chk2 antibody
<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>ATF3 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>Degré de pureté :Min. 95%Mouse Thymocyte antibody
<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>Degré de pureté :Min. 95%EVI2A antibody
<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>Degré de pureté :Min. 95%GSR antibody
<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>Degré de pureté :Min. 95%CDKN1B antibody
<p>The CDKN1B antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase inhibitor 1B (CDKN1B). CDKN1B is a protein that plays a crucial role in cell cycle regulation and acts as a tumor suppressor. This antibody binds to CDKN1B and inhibits its function, leading to uncontrolled cell growth and proliferation.</p>GFAP antibody
<p>The GFAP antibody is a highly specialized polyclonal antibody that is used in Life Sciences research. It is designed to target and neutralize autoantibodies against glial fibrillary acidic protein (GFAP), which is an important marker for astrocytes in the central nervous system. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>Degré de pureté :Min. 95%TRIM45 antibody
<p>TRIM45 antibody was raised using the middle region of TRIM45 corresponding to a region with amino acids EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP</p>VSIG1 antibody
<p>VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN</p>Degré de pureté :Min. 95%p53 antibody
<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody is commonly used in research laboratories and medical institutions for various applications.</p>KEAP1 antibody
<p>The KEAP1 antibody is a highly specialized monoclonal antibody that targets KEAP1, a protein involved in the regulation of cellular responses to oxidative stress. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and neurodegenerative disorders.</p>RBM14 antibody
<p>RBM14 antibody was raised in rabbit using the N terminal of RBM14 as the immunogen</p>Degré de pureté :Min. 95%ORC6L antibody
<p>ORC6L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE</p>Degré de pureté :Min. 95%EphA2 antibody
<p>EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.</p>STEAP2 antibody
<p>The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.</p>AFP antibody
<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a protein that is produced during fetal development and in certain cancers. This antibody has been shown to inhibit the growth of endothelial cells, which play a crucial role in tumor angiogenesis. Additionally, the AFP antibody has been used in research studies to investigate the potential therapeutic effects of targeting keratinocyte growth factor (KGF) signaling pathways. It has also demonstrated neutralizing activity against other growth factors, such as VEGF and circumsporozoite protein. The AFP antibody may have potential applications in the field of life sciences and could be a valuable tool for researchers studying cancer biology and developing targeted therapies.</p>PCDH8 antibody
<p>PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG</p>Degré de pureté :Min. 95%RGS8 antibody
<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>Degré de pureté :Min. 95%GPT2 protein (His tag)
<p>Purified recombinant Human GPT2 protein (His tag)</p>Degré de pureté :Min. 95%IL1b antibody (biotin)
<p>IL1b antibody (biotin) was raised in goat using E. Coli derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>LPAR1 antibody
<p>The LPAR1 antibody is a monoclonal antibody that targets the Lysophosphatidic Acid Receptor 1 (LPAR1). It plays a crucial role in various cellular processes, including cell growth, migration, and survival. This antibody has been extensively studied in the field of life sciences and has shown promising results.</p>Thyroglobulin protein
<p>Human Thyroglobulin (Tg) is a large glycoprotein produced by the thyroid gland, serving as a precursor for the production of thyroid hormones, thyroxine (T₄) and triiodothyronine (T₃). It is synthesized and stored in the thyroid follicular cells, where it plays a crucial role in hormone synthesis by binding iodine and undergoing enzymatic processing to release active thyroid hormones into the bloodstream.</p>Degré de pureté :>98% Pure By Sds PagePKD2 antibody (Ser876)
<p>Human phosphopeptide (Ser876) immunogen; rabbit polyclonal PKD2 antibody (Ser876)</p>Mouse anti Rat IgG (Fc) (HRP)
<p>Rat IgG antibody was raised in mouse using Rat IgG Fc region as the immunogen.</p>Degré de pureté :Min. 95%POR antibody
<p>The POR antibody is a monoclonal antibody that targets the growth factor POR (Peroxidase). This antibody is used for immobilization studies and can be activated by chemical agents. It specifically binds to the cation channel and glycoprotein POR, allowing for easy detection and analysis. The POR antibody has been extensively tested in Life Sciences research and has shown high specificity and sensitivity. It can be used in various applications such as Western blotting, ELISA, immunohistochemistry, and flow cytometry. Additionally, this monoclonal antibody has been proven effective in studying arginase and lipoprotein lipase. Trust the POR antibody for reliable results in your research experiments.</p>PCNA antibody
<p>The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.</p>
