Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.116 produits)
- Par Biological Target(99.075 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.700 produits)
- Métabolites secondaires(14.220 produits)
130578 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HSPA2 antibody
<p>HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK</p>Degré de pureté :Min. 95%PON1 antibody
<p>The PON1 antibody is a monoclonal antibody used in Life Sciences research. It is designed to neutralize the activity of acetylcholine esterase, an enzyme involved in cholinergic neurotransmission. By binding to and inhibiting this enzyme, the PON1 antibody can modulate the effects of acetylcholine in various biological processes. Additionally, this antibody has been shown to react with other targets such as levothyroxine, interleukin-6, and acetyltransferase. It may also have potential applications in studying autoimmune disorders characterized by the production of autoantibodies against basic proteins like collagen and cytokines like TNF-α. With its specificity and versatility, the PON1 antibody is a valuable tool for researchers exploring the intricacies of cholinergic signaling and related pathways.</p>C1ORF184 antibody
<p>C1ORF184 antibody was raised using the C terminal Of C1Orf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV</p>CD3 antibody
<p>The CD3 antibody is a highly effective and versatile tool used in Life Sciences. It is a monoclonal antibody that specifically targets CD3, a protein found on the surface of T cells. This antibody is widely used in research and diagnostic applications.</p>Carbonic Anhydrase VIII Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA8 antibody, catalog no. 70R-2586</p>Degré de pureté :Min. 95%Hepatitis C Virus antibody
<p>Hepatitis C virus antibody was raised in mouse using highly pure HCV NS5a as the immunogen.</p>FHIT antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>ASF1A protein (His tag)
<p>1-204 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMAKV QVNNVVVLDN PSPFYNPFQF EITFECIEDL SEDLEWKIIY VGSAESEEYD QVLDSVLVGP VPAGRHMFVF QADAPNPGLI PDADAVGVTV VLITCTYRGQ EFIRVGYYVN NEYTETELRE NPPVKPDFSK LQRNILASNP RVTRFHINWE DNTEKLEDAE SSNPNLQSLL STDALPSASK GWSTSENSLN VMLESHMDCM</p>26S Proteasome P52 Subunit antibody
<p>26S Proteasome P52 Subunit antibody was raised in mouse using 26S proteasomes purified from Xenopus laevis ovary as the immunogen.</p>MAP3K7IP1 antibody
<p>MAP3K7IP1 antibody was raised using the N terminal of MAP3K7IP1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE</p>Degré de pureté :Min. 95%Insulin Receptor α antibody
<p>The Insulin Receptor alpha antibody is a monoclonal antibody that specifically targets the insulin receptor alpha subunit. It plays a crucial role in regulating glucose metabolism and is involved in various cellular processes such as growth, differentiation, and survival. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting insulin signaling pathways.</p>Donkey anti Chicken IgY (H + L) (12 nm Gold Colloid)
<p>Donkey anti-chicken IgY (H + L) (12 nm Gold Colloid) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>Degré de pureté :Min. 95%TAMRA antibody
<p>The TAMRA antibody is a cytotoxic monoclonal antibody that specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The TAMRA antibody binds to TNF-α, preventing it from binding to its receptors and exerting its pro-inflammatory effects. This inhibition of TNF-α activity can help reduce inflammation and alleviate symptoms associated with various inflammatory conditions.</p>Dog RBC antibody (Texas Red)
<p>Canine RBC antibody (Texas Red) was raised in rabbit using canine erythrocytes as the immunogen.</p>PPP2R3A antibody
<p>PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD</p>ZNF551 antibody
<p>ZNF551 antibody was raised in rabbit using the N terminal of ZNF551 as the immunogen</p>Degré de pureté :Min. 95%Gentamicin-BSA
<p>Gentamicin-BSA is a medicament used in Life Sciences research. It is a Hapten Conjugate that consists of Gentamicin, a broad-spectrum antibiotic, and BSA (Bovine Serum Albumin), a protein commonly used as an antigen carrier. This conjugate is designed to target specific molecules or proteins of interest in various biological studies.</p>Degré de pureté :Min. 95%ICK antibody
<p>The ICK antibody is a highly specialized antibody that targets the tyrosine kinase receptor, which plays a crucial role in growth factor signaling. This antibody is designed to specifically bind to the receptor and inhibit its activity, thereby blocking the downstream signaling pathways involved in cell growth and proliferation.</p>RGS16 antibody
<p>The RGS16 antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications. This monoclonal antibody specifically targets alpha-fetoprotein, an important protein found in human serum. It has also demonstrated remarkable anti-mesothelin activity, making it a potential therapeutic option for mesothelioma treatment.</p>BVES antibody
<p>BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS</p>Degré de pureté :Min. 95%GNMT antibody
<p>The GNMT antibody is a highly specialized monoclonal antibody that targets the growth factor, epidermal growth factor (EGF). It has been developed for use in Life Sciences research and is particularly useful for studying biomolecules and their interactions. The GNMT antibody can be immobilized on various surfaces such as colloidal electrodes or used in assays to detect the presence of EGF in samples like human serum or liver microsomes. This antibody exhibits cytotoxic effects, making it an excellent tool for investigating cellular responses to EGF stimulation. Additionally, the GNMT antibody has shown potential applications in cancer research, as it specifically recognizes alpha-fetoprotein (AFP), a biomarker associated with certain types of tumors. It is important to note that this antibody should be handled with care due to its nephrotoxic properties.</p>MKRN2 antibody
<p>MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS</p>CD235a antibody
<p>The CD235a antibody is a neutralizing monoclonal antibody that is used in Life Sciences research. It has been shown to have natriuretic effects and can be used to study amyloid plaque formation in the brain. This antibody specifically targets activated chimeric proteins and can be used in various applications, such as electrode coating for enhanced signal detection. Additionally, the CD235a antibody has cytotoxic properties and can be conjugated with drugs or toxins for targeted therapy. It also binds to tissue transglutaminase and brain natriuretic peptide, making it a valuable tool for studying these proteins in different biological systems.</p>Hexokinase 1 human
CAS :<p>Hexokinase 1 is a human protein that catalyzes the first step in the glycolysis pathway. It is a hexameric protein with a molecular weight of about 380 kDa. Hexokinase 1 is an important enzyme for glucose metabolism and has been used as a transgene to study the effects of high blood sugar levels on vascular function in mice.</p>Degré de pureté :Min. 95%Lamin A antibody
<p>The Lamin A antibody is a cytotoxic monoclonal antibody that targets elastase, autoantibodies, lectins, insulin, fibronectin, and collagen. It is commonly used in Life Sciences research to detect and study the expression of Lamin A protein. This antibody specifically binds to Lamin A and can be used in various applications such as immunofluorescence, immunohistochemistry, and Western blotting. Additionally, it has been shown to have anti-VEGF (vascular endothelial growth factor) activity and can be used in the development of therapeutic treatments for angiogenesis-related diseases. The Lamin A antibody is an essential tool for researchers studying cellular processes and protein interactions involved in various biological pathways.</p>FAM50A protein (His tag)
<p>Purified recombinant FAM50A protein (His tag)</p>Degré de pureté :Min. 95%IL10 antibody
<p>IL10 antibody was raised in rabbit using highly pure recombinant rat IL-10 as the immunogen.</p>Degré de pureté :Min. 95%Estrogen-Related Receptor γ Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRG antibody, catalog no. 70R-2648</p>Degré de pureté :Min. 95%Thioredoxin 2 antibody
<p>Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ</p>RPA4 antibody
<p>RPA4 antibody was raised using the C terminal of RPA4 corresponding to a region with amino acids HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD</p>Degré de pureté :Min. 95%RHOC antibody
<p>The RHOC antibody is a highly specialized product used in the field of Life Sciences. This antibody specifically targets the basic protein RHOC, which plays a crucial role in various cellular processes. The RHOC antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.</p>UBTD2 antibody
<p>UBTD2 antibody was raised in rabbit using the C terminal of UBTD2 as the immunogen</p>SF3A3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3A3 antibody, catalog no. 70R-4856</p>Degré de pureté :Min. 95%TPD52 antibody
<p>TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG</p>Casein Kinase 1 α antibody
<p>Casein Kinase 1 alpha antibody was raised in mouse using recombinant human Casein Kinase 1 alpha (1-337aa) purified from E. coli as the immunogen.</p>NTSR1 antibody
<p>NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT</p>Degré de pureté :Min. 95%CHRM3 antibody
<p>CHRM3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%LGALS3BP antibody
<p>LGALS3BP antibody was raised using the middle region of LGALS3BP corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS</p>Degré de pureté :Min. 95%Goat anti Human IgG (biotin)
<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>Degré de pureté :Min. 95%ISG15 antibody
<p>ISG15 antibody was raised in rabbit using the middle region of ISG15 as the immunogen</p>Degré de pureté :Min. 95%ARL6IP2 antibody
<p>ARL6IP2 antibody was raised using the C terminal of ARL6IP2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ</p>Degré de pureté :Min. 95%S6 antibody
<p>The S6 antibody is a powerful tool used in various research applications. It is a cholinergic growth factor that has been extensively studied in the context of breast cancer, particularly in the MCF-7 cell line. This antibody targets acetyltransferase, an enzyme involved in the synthesis of acetylcholine, a neurotransmitter implicated in cell growth and proliferation.</p>Dextromethorphan antibody
<p>Dextromethorphan antibody is an antibody that specifically targets and binds to dextromethorphan, a commonly used cough suppressant. This antibody has been shown to have various effects on adipocytes, including modulation of glycosylation and regulation of E-cadherin expression. Additionally, it has been found to interact with insulin antibodies and impact superoxide production. Both polyclonal and monoclonal forms of this antibody are available, allowing for different applications and research needs. The use of dextromethorphan antibody can provide valuable insights into the mechanisms underlying the effects of this cough suppressant on cellular processes such as fatty acid metabolism and immune responses mediated by IFN-gamma.</p>Degré de pureté :Min. 95%MCP3 antibody
<p>MCP3 antibody was raised in goat using with highly pure recombinant human MCP-3 as the immunogen.</p>Degré de pureté :Min. 95%PDE1C antibody
<p>PDE1C antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Erythromycin antibody
<p>The Erythromycin antibody is a polyclonal antibody that specifically targets erythromycin, a macrolide antibiotic used in the treatment of various bacterial infections. This antibody has been extensively tested and shown to have high specificity and affinity for erythromycin. It can be used in various life science applications, including neutralizing erythromycin activity, detecting its presence in samples through immunohistochemistry or Western blotting, and studying its mechanism of action.</p>Degré de pureté :Min. 95%CDK2 antibody
<p>The CDK2 antibody is a highly effective tool for researchers in the field of life sciences. This monoclonal antibody specifically targets and binds to the activated form of CDK2, a crucial protein involved in cell cycle regulation. By inhibiting the activity of CDK2, this antibody can effectively block cell proliferation and growth.</p>OCIAD2 antibody
<p>OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG</p>Goat anti Mouse IgG (Fab'2) (FITC)
<p>Goat anti-mouse IgG (Fab'2) (FITC) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.</p>Degré de pureté :Min. 95%PARP3 antibody
<p>PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP</p>KSP Cadherin antibody
<p>The KSP Cadherin antibody is a highly specific antibody that targets the KSP (Kidney-Specific Protein) Cadherin. This transmembrane glycoprotein plays a crucial role in pluripotent stem cell differentiation and development. The antibody has been extensively studied and found to be effective in various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>PKCK2 α protein (His tag)
<p>1-391 amino acids: MGSSHHHHHH SSGLVPRGSH MSGPVPSRAR VYTDVNTHRP REYWDYESHV VEWGNQDDYQ LVRKLGRGKY SEVFEAINIT NNEKVVVKIL KPVKKKKIKR EIKILENLRG GPNIITLADI VKDPVSRTPA LVFEHVNNTD FKQLYQTLTD YDIRFYMYEI LKALDYCHSM GIMHRDVKPH NVMIDHEHRK LRLIDWGLAE FYHPGQEYNV RVASRYFKGP ELLVDYQMYD YSLDMWSLGC MLASMIFRKE PFFHGHDNYD QLVRIAKVLG TEDLYDYIDK YNIELDPRFN DILGRHSRKR WERFVHSENQ HLVSPEALDF LDKLLRYDHQ SRLTAREAME HPYFYTVVKD QARMGSSSMP GGSTPVSSAN MMSGISSVPT PSPLGPLAGS PVIAAANPLG MPVPAAAGAQ Q</p>Degré de pureté :Min. 95%ATP6V1F protein (His tag)
<p>Recombinant Human ATP6V1F protein (His tag)</p>Degré de pureté :Min. 95%PTH antibody
<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>Degré de pureté :Min. 95%ME1 antibody
<p>ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL</p>MAVS protein (His tag)
<p>Purified recombinant Human MAVS protein (His tag)</p>Degré de pureté :Min. 95%FZD4 antibody
<p>FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV</p>Degré de pureté :Min. 95%ALDH1B1 antibody
<p>The ALDH1B1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of antibodies and is specifically designed to target hematopoietic stem cells. This chromogenic antibody is widely used in research and diagnostic applications to detect the presence of ALDH1B1 antigen.</p>WDHD1 antibody
<p>WDHD1 antibody was raised in rabbit using the middle region of WDHD1 as the immunogen</p>Degré de pureté :Min. 95%TeripaRatide Acetate
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C181H291N55O51S2Masse moléculaire :4,117.8 g/molCRYAB antibody
<p>The CRYAB antibody is a monoclonal antibody that targets CRYAB, also known as alpha-crystallin B chain. This antibody is widely used in Life Sciences research to study the function and expression of CRYAB. CRYAB is a small heat shock protein that plays a crucial role in protecting cells from oxidative damage and maintaining cellular homeostasis. It is highly expressed in tissues such as the heart, skeletal muscles, and lens of the eye. The CRYAB antibody can be used for various applications including Western blotting, immunohistochemistry, and flow cytometry to detect and quantify CRYAB levels in different samples. Its high specificity and sensitivity make it an essential tool for researchers studying oxidative stress, protein aggregation, and neurodegenerative diseases.</p>
