Produits biochimiques et réactifs

<p>CA8 antibody was raised in Rabbit using Human CA8 as the immunogen</p>

<p>Pseudomonas aeruginosa serotype 16c Monoclonal Antibody</p>

<p>Mouse monoclonal CD99 antibody (PE)</p>

<p>BD3 antibody was raised in rabbit using highly pure recombinant human BD-3 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DEPDC1 antibody, catalog no. 70R-9384</p>

<p>The GAPDH Blocking Peptide is a highly effective peptide that belongs to the category of Peptides and Biochemicals. It is specifically designed to block the activity of glyceraldehyde 3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis. By inhibiting the function of GAPDH, this blocking peptide can effectively prevent the binding of monoclonal antibodies to extracellular histones, thereby reducing their cytotoxic effects.</p>

<p>Cytokeratin 6 antibody was raised in mouse using cytokeratin 6 of human callus cytoskeletal preparation as the immunogen.</p>

<p>HBP1 antibody was raised in rabbit using the middle region of HBP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNRG antibody, catalog no. 70R-5088</p>

<p>NEFH antibody was raised in Rabbit using Human NEFH as the immunogen</p>

<p>GCLC antibody was raised in rabbit using the middle region of GCLC as the immunogen</p>

<p>The ATF2 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to ATF2, a protein involved in various cellular processes such as gene regulation and DNA repair. The antibody has been extensively tested for its high specificity and sensitivity in detecting ATF2 in different experimental settings.</p>

<p>4-((5-Allyl-2-phenyl-6-(trifluoromethyl)pyrimidin-4-yl)(methyl)amino)benzoic acid is a peptide that has been shown to activate ion channels, as well as inhibit the binding of ligands to receptors. It is also an inhibitor of protein interactions in cell biology and pharmacology. This product is used primarily as a research tool for studying ion channel function.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-1468</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLUL1 antibody, catalog no. 70R-3976</p>

<p>Affinity purified Rabbit polyclonal Unc182 antibody</p>

<p>Mouse monoclonal Hemopexin antibody (Biotin)</p>

<p>Rabbit polyclonal cKit antibody (Tyr721)</p>

<p>Purified Polyclonal DIAPH2 antibody</p>

<p>SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CUEDC1 antibody, catalog no. 70R-1277</p>

<p>Recombinant Human PLA2G7 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALNT1 antibody, catalog no. 70R-6346</p>

<p>Recombinant human PSMB10 protein (His tag)</p>

<p>Slc9a3r2 antibody was raised in rabbit using the N terminal of Slc9a3r2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GMFG antibody, catalog no. 70R-6206</p>

<p>HLA DP DQ DR Monoclonal Antibody</p>

<p>Rabbit polyclonal TNPO2 antibody</p>

<p>The TGFBR3 antibody is a valuable tool in the field of Life Sciences. It specifically targets the monophosphate growth factor receptor, TGFBR3, and can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry. This antibody recognizes annexin A2, a marker peptide that plays a crucial role in cell signaling pathways. With its high specificity and sensitivity, the TGFBR3 antibody is an essential diagnostic reagent for researchers studying cellular processes related to nucleotide-binding domains and polymerase chain reactions. Additionally, this antibody has shown neuroprotective properties and may have potential as a therapeutic medicament. Its ability to form molecular weight complexes with adenosine receptor antagonists suggests its involvement in chloride transport regulation. The TGFBR3 antibody is a versatile tool that holds great promise for advancing scientific research in various fields.</p>

<p>Rabbit Polyclonal Keratin 18 antibody (Ser33)</p>

<p>TRAF1 antibody was raised in rabbit using the middle region of TRAF1 as the immunogen</p>

<p>AGPAT9 antibody was raised in Rabbit using Human AGPAT9 as the immunogen</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>AMPD2 antibody was raised in Rabbit using Human AMPD2 as the immunogen</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>Rabbit polyclonal ATR antibody (Ser428)</p>

<p>Rabbit polyclonal FRS2 antibody (Tyr436)</p>

<p>The Elk1 antibody is a biomolecule that specifically targets the Elk1 protein, making it an essential tool in life sciences research. This polyclonal antibody recognizes the glycoprotein Elk1, which plays a crucial role in various cellular processes. It is involved in gene transcription and acts as a transcription factor that regulates the expression of genes involved in cell proliferation, differentiation, and survival.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UMOD antibody, catalog no. 70R-5800</p>

<p>The FOLH1 protein is a recombinant protein that belongs to the category of Recombinant Proteins &amp; Antigens. It is colloidal in nature and has been shown to have anti-VEGF (vascular endothelial growth factor) properties. Additionally, it has caspase-9 inhibitory activity and acts as a globulin-like growth factor. The FOLH1 protein also possesses antiviral properties and has been found to be effective against certain viruses. It is commonly used in adipose tissue research and formulation of therapeutics.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SULT2B1 antibody, catalog no. 70R-2605</p>

<p>1-480 amino acids: MGSSHHHHHH SSGLVPRGSH TRSMNASEFR RRGKEMVDYV ANYMEGIEGR QVYPDVEPGY LRPLIPAAAP QEPDTFEDII NDVEKIIMPG VTHWHSPYFF AYFPTASSYP AMLADMLCGA IGCIGFSWAA SPACTELETV MMDWLGKMLE LPKAFLNEKA GEGGGVIQGS ASEATLVALL AARTKVIHRL QAASPELTQA AIMEKLVAYS SDQAHSSVER AGLIGGVKLK AIPSDGNFAM RASALQEALE RDKAAGLIPF FMVATLGTTT CCSFDNLLEV GPICNKEDIW LHVDAAYAGS AFICPEFRHL LNGVEFADSF NFNPHKWLLV NFDCSAMWVK KRTDLTGAFR LDPTYLKHSH QDSGLITDYR HWQIPLGRRF RSLKMWFVFR MYGVKGLQAY IRKHVQLSHE FESLVRQDPR FEICVEVILG LVCFRLKGSN KVNEALLQRI NSAKKIHLVP CHLRDKFVLR FAICSRTVES AHVQRAWEHI KELAADVLRA ERE</p>

<p>The ELL antibody is a highly specialized neutralizing antibody that plays a crucial role in the field of Life Sciences. This antibody specifically targets insulin, a hormone involved in regulating blood sugar levels and metabolism. It is commonly used in research and diagnostic applications to detect and measure insulin levels in various biological samples.</p>

<p>Rabbit polyclonal ZBED1 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AHCYL1 antibody, catalog no. 70R-3882</p>

<p>Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW</p>

<p>SOX7 antibody was raised in rabbit using the N terminal of SOX7 as the immunogen</p>

<p>DOK2 antibody was raised in Rabbit using Human DOK2 as the immunogen</p>

<p>Rabbit polyclonal GPR83 antibody</p>

<p>Mouse monoclonal Hexokinase 2 antibody (N-terminus)</p>

<p>Purified recombinant GCET2 protein</p>

<p>The LRG1 Blocking Peptide is a highly effective monoclonal antibody that acts as a phosphatase inhibitor in Life Sciences research. This neutralizing peptide is widely used in the field of monoclonal antibodies and has been proven to effectively block the activity of LRG1, a glycoprotein involved in various biological processes.</p>

<p>382-501 amino acids: MGSSHHHHHH SSGLVPRGSH MAPLATRQGK RPSKNLKARC SRKALHVNFK DMGWDDWIIA PLEYEAFHCE GLCEFPLRSH LEPTNHAVIQ TLMNSMDPES TPPTCCVPTR LSPISILFID SANNVVYKQY EDMVVESCGC R</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

<p>Rabbit polyclonal eNOS antibody (Thr494)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOSR1 antibody, catalog no. 70R-9802</p>

<p>Hemopexin antibody is a highly specialized monoclonal antibody that is reactive against hemopexin, a protein found in human serum. This antibody can be used as an inhibitor to study the function of hemopexin in various life sciences applications. It can also be immobilized on electrodes for use in diagnostic assays or other research purposes. Additionally, this monoclonal antibody has shown neutralizing activity against interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various diseases and conditions. Its unique properties make it a valuable tool for researchers studying the role of hemopexin and IL-6 in different biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HELLS antibody, catalog no. 70R-4647</p>

<p>Purified recombinant RAD51D protein (His tag)</p>

<p>Purified recombinant UQCRC2 protein (His tag)</p>

<p>Mouse monoclonal EAPII antibody</p>

<p>Purified Polyclonal ORC1 antibody</p>

<p>VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF</p>

<p>SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL</p>

<p>Rabbit polyclonal LW1 antibody</p>

<p>GSR antibody was raised in Rabbit using Human GSR as the immunogen</p>

<p>Rabbit polyclonal HTR2C antibody</p>

<p>Rabbit Polyclonal LIMK1 antibody (Thr508)</p>

<p>ZNF499 antibody was raised in rabbit using the middle region of ZNF499 as the immunogen</p>

<p>The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.</p>

<p>Purified Polyclonal Apolipoprotein F antibody</p>

<p>Rabbit polyclonal CNAP1 antibody</p>

<p>Purified recombinant U2AF1 protein (His tag)</p>

<p>Desmin antibody is a monoclonal antibody that targets desmin, a protein involved in the structural organization of muscle cells. It has been widely used in Life Sciences research to study various cellular processes such as cell migration, differentiation, and apoptosis. The desmin antibody has also been utilized in hybridization techniques to detect specific proteins or molecules of interest. Additionally, this antibody has shown potential therapeutic applications due to its ability to inhibit the growth factor TGF-beta and anti-VEGF (vascular endothelial growth factor). Furthermore, it has exhibited cytotoxic effects on human hepatocytes and pancreatic elastase activity, making it a promising candidate for medicament development.</p>

<p>The STAT1 antibody is a highly specialized antibody that targets and neutralizes the activity of STAT1, a protein involved in cell signaling and immune response. This antibody has been extensively studied and has shown to be effective in blocking the activation of STAT1, preventing its cytotoxic effects. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.</p>

<p>Affinity purified Rabbit polyclonal MAGI2 antibody</p>

<p>Presenilin 1 antibody is a highly specific antibody that is used in various life sciences research applications. This polyclonal antibody targets presenilin 1, a protein that plays a crucial role in the formation of the γ-secretase complex and the processing of amyloid precursor protein (APP). The antibody has been extensively validated and shown to have high affinity and specificity for presenilin 1.</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLA2 antibody, catalog no. 70R-10094</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54L antibody, catalog no. 70R-5645</p>

<p>Rabbit Polyclonal TrkA antibody (Ser791)</p>

<p>MESP2 antibody was raised in rabbit using the C terminal of MESP2 as the immunogen</p>

<p>Rabbit polyclonal GABRB1 antibody (Ser434)</p>

<p>Purified recombinant Human EIF1AX protein</p>

<p>CD31 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that targets CD31, also known as platelet endothelial cell adhesion molecule-1 (PECAM-1). CD31 is a transmembrane glycoprotein expressed on the surface of endothelial cells, platelets, and leukocytes. It plays a crucial role in cell adhesion, angiogenesis, and vascular integrity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of D930005D10RIK antibody, catalog no. 20R-1172</p>

<p>(R)-5-Fluoro-N-(4-fluoro-3-(3-imino-2,5-dimethyl-1,1-dioxido-1,2,4-thiadiazinan-5-yl)phenyl)picolinamide 2,2,2-trifluoroacetate is a sophisticated chemical compound, primarily utilized in the field of pharmaceutical research. Derived from synthetic organic chemical processes, this compound represents a class of advanced heteroaryl amides with potential bioactive properties. Its unique mode of action is centered on its ability to engage in binding interactions, presumably with specific protein targets or enzymes, influencing molecular pathways related to disease states.</p>

<p>The VCP antibody is a highly specialized antibody that targets various proteins involved in crucial cellular processes. It specifically recognizes β-catenin, c-myc, alpha-synuclein, and other nuclear proteins. This antibody is widely used in the field of Life Sciences for research purposes.</p>

<p>The FGR antibody is a highly specialized antibody that targets extracellular histones and acts as a growth factor. It has the unique ability to neutralize human folate, making it an essential tool in research and medical applications. This antibody also plays a crucial role in detecting alpha-fetoprotein and autoantibodies, providing valuable insights into various diseases and conditions. Additionally, the FGR antibody can inhibit interferon activity, making it an excellent candidate for therapeutic use. With its wide range of applications in life sciences and the study of chemokines, this polyclonal antibody is a versatile tool for researchers and scientists alike.</p>

<p>RFXAP antibody was raised in mouse using recombinant Regulatory Factor X-Associated Protein (Rfxap)</p>

<p>Rabbit polyclonal MRPL44 antibody</p>

<p>Goat anti-mouse IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using Mouse IgG, IgA, IgM whole molecules as the immunogen.</p>

<p>The p73 antibody is a type of antibody that specifically targets the p73 protein. It is an autoantibody, meaning it is produced by the body's immune system in response to the presence of p73. This antibody has been shown to play a role in various biological processes, including the formation of amyloid plaques and the regulation of cell growth and development.</p>

<p>The CRYAB antibody is a highly sensitive protein detection tool that utilizes colloidal gold-labeled monoclonal antibodies. This antibody specifically targets the CRYAB protein, which is involved in various cellular processes. It can be used for ultrasensitive detection of CRYAB in different samples, including human serum and tissue lysates. The CRYAB antibody is immobilized on an electrode, allowing for easy and efficient detection. Additionally, this antibody has neutralizing capabilities, making it suitable for functional studies of CRYAB. Whether you are conducting research in the field of life sciences or developing diagnostic assays, the CRYAB antibody is an essential tool for accurate and reliable protein detection.</p>

<p>HIST3H3 antibody was raised in rabbit using the N terminal of HIST3H3 as the immunogen</p>

<p>Purified recombinant Human MORF4L2 protein</p>

<p>UNC5C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS</p>

<p>Rabbit polyclonal EIF4E3 antibody</p>

<p>Rabbit polyclonal Ezrin antibody (Tyr146)</p>