Produits biochimiques et réactifs

<p>Purified recombinant IFNG protein (His tag)</p>

<p>MAP2K3 antibody was raised in Rabbit using Human MAP2K3 as the immunogen</p>

<p>Goat anti-rat IgG (Fab'2) (HRP) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>TMPRSS11D antibody was raised using the middle region of TMPRSS11D corresponding to a region with amino acids IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC</p>

<p>The CD133 antibody is a highly specialized monoclonal antibody that has been activated to target specific glycan structures on the surface of cells. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody is capable of neutralizing chemokine receptors such as CXCR4 and can also inhibit the activity of colony-stimulating factors like GM-CSF and interleukin-6. The CD133 antibody is widely used in research laboratories for its ability to specifically bind to CD133-expressing cells, allowing for their identification and isolation. It is also commonly used in diagnostic assays and therapeutic development. For those seeking high-quality antibodies, the CD133 antibody is a reliable choice that offers exceptional specificity and sensitivity.</p>

<p>ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG</p>

<p>Rabbit polyclonal TNFSF11 antibody (biotin)</p>

<p>Rabbit polyclonal RPS27 antibody</p>

<p>BVES antibody was raised in Rabbit using Human BVES as the immunogen</p>

<p>The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.</p>

<p>AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG</p>

<p>Mouse monoclonal Kappa Light Chain antibody (HRP)</p>

<p>Mouse monoclonal CD205 antibody (FITC)</p>

<p>Goat anti Mouse IgG (H + L) (rhodamine) secondary antibody</p>

<p>EphB3 antibody was raised in Mouse using a purified recombinant fragment of EphB3(aa39-212) expressed in E. coli as the immunogen.</p>

<p>VHL antibody was raised in rabbit using the N terminal of VHL as the immunogen</p>

<p>Rabbit polyclonal USMG5 antibody</p>

<p>Donkey anti Goat IgG (H + L) secondary antibody (Alk phos)</p>

<p>Rabbit polyclonal SLC27A4 antibody</p>

<p>Purified recombinant PCID2 protein (His tag)</p>

<p>Purified Rabbit polyclonal PLRG1 antibody</p>

<p>The TPI1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the TPI1 protein, which is involved in the regulation of pro-inflammatory cytokines and TGF-beta signaling pathways. This antibody can be used to study the effects of various compounds, such as gabapentin or ketorolac, on TPI1 expression and function. The TPI1 antibody can also be conjugated to magnetic particles for use in immunomagnetic separation techniques or used in combination with other antibodies to study interactions between proteins. Additionally, this antibody has been shown to inhibit collagen production and endothelial cell proliferation, making it a valuable tool for studying these processes in vitro.</p>

<p>C1QTNF7 antibody was raised using the middle region of C1QTNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI</p>

<p>The CPN60 antibody is a powerful tool used in the field of Life Sciences. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody specifically targets the CPN60 protein, which is involved in various cellular processes.</p>

<p>F7 antibody was raised in rabbit using the C terminal of F7 as the immunogen</p>

<p>Rabbit polyclonal GPR115 antibody</p>

<p>SLC9A3 antibody was raised in rabbit using the middle region of SLC9A3 as the immunogen</p>

<p>The FAS antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitory factor, specifically targeting the FAS protein. This acidic antibody has the ability to bind to collagen, insulin, and fibronectin, among other molecules. By binding to the FAS receptor, this antibody can induce fas-mediated apoptosis, a process that leads to targeted cell death. Additionally, it has shown cytotoxic effects against various cell types.</p>

<p>Rabbit polyclonal DDX39B antibody (biotin)</p>

<p>EPO antibody was raised in Mouse using a purified recombinant fragment of human EPO expressed in E. coli as the immunogen.</p>

<p>URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR</p>

<p>Rat monoclonal ICOS antibody (biotin)</p>

<p>Mouse monoclonal PRMT2 antibody</p>

<p>Purified native Porcine Bilirubin protein</p>

<p>ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG</p>

<p>The RBP4 monoclonal antibody is a powerful tool in the field of Life Sciences. It is a DNA aptamer that specifically targets and binds to TGF-β1, an activated growth factor involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in the detection and quantification of TGF-β1 in various biological samples.</p>

<p>ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool for researchers in the field of Life Sciences. This monoclonal antibody specifically targets tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine. By binding to and neutralizing this enzyme, the antibody effectively inhibits the production of dopamine, allowing researchers to study its role in various biological processes.</p>

<p>Purified Native Rabbit GAPDH protein</p>

<p>Rabbit polyclonal FOXH1 antibody</p>

<p>The SOX17 antibody is a highly specialized monoclonal antibody that targets the SOX17 protein. This protein plays a crucial role in various biological processes, including cell differentiation and development. The antibody specifically binds to the SOX17 protein, neutralizing its activity.</p>

<p>Rabbit polyclonal CXCL5 antibody (FITC)</p>

<p>BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL</p>

<p>Rabbit polyclonal CCRL1 antibody</p>

<p>The STAT5A antibody is a monoclonal antibody that specifically targets the oncogenic kinase STAT5A. It plays a crucial role in regulating cellular responses to interleukin-6, a potent growth factor and mitogen-activated protein. This antibody acts by inhibiting the phosphorylation of STAT5A, preventing its translocation to the nucleus and subsequent activation of target genes. In addition, it has been shown to induce apoptosis and inhibit cell proliferation in various cancer cell lines. The STAT5A antibody is a valuable tool for researchers in the field of Life Sciences who are studying the role of STAT5A in cellular signaling pathways and its potential as a therapeutic target for cancer treatment.</p>

<p>Rabbit polyclonal SMG5 antibody</p>

<p>Rabbit polyclonal SHC antibody (Tyr349)</p>

<p>Transferrin protein is a biomolecule that plays a crucial role in iron transport and homeostasis. It is involved in binding and transporting iron throughout the body, ensuring that it reaches the cells where it is needed. Transferrin protein has been extensively studied for its potential therapeutic applications. One such application is its ability to neutralize the effects of oral haloperidol, a commonly used antipsychotic medication. Studies have shown that transferrin protein can bind to haloperidol and reduce its side effects, such as extrapyramidal symptoms and hyperprolactinemia. This interaction between transferrin protein and haloperidol highlights the potential for targeted drug delivery and improved treatment outcomes. Furthermore, transferrin protein has been investigated for its glycosylation patterns, which can impact its stability, function, and immunogenicity. Understanding these glycosylation patterns can aid in the development of recombinant proteins and antigens with enhanced properties. In</p>

<p>Alien antibody was raised in rabbit using Residues 239-250 [ECGGKMHLREGE] of Alien as the immunogen.</p>

<p>Purified Polyclonal BMP5 antibody</p>

<p>The GAPDH antibody is a highly effective monoclonal antibody that has been activated to target specific proteins in the body. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody has been found to neutralize the activity of TGF-beta, a protein involved in cell growth and differentiation. Additionally, it has shown to have glycosylation properties, which can impact protein function and stability. One of the key targets of the GAPDH antibody is E-cadherin, a protein responsible for cell adhesion and tissue integrity. By binding to E-cadherin, this antibody can modulate cell-cell interactions and potentially influence cellular behavior. Furthermore, studies have demonstrated that the GAPDH antibody can inhibit collagen production, which is crucial for maintaining tissue structure and elasticity. This property may have implications in wound healing and tissue regeneration. Another important aspect of the GAPDH antibody is its ability to regulate microvessel density. By targeting specific proteins involved in angiogenesis, this</p>

<p>PITPNM1 antibody was raised in rabbit using the N terminal of PITPNM1 as the immunogen</p>

<p>The MAP3K8 antibody is a highly effective test substance that targets protein kinase, an essential factor in cellular signaling pathways. This antibody acts as an inhibitor of protein kinase kinase, preventing its activity and disrupting downstream signaling events. The MAP3K8 antibody is delivered in liposome form, ensuring optimal delivery and efficacy. It is widely used in the field of Life Sciences for research purposes. With its potent inhibitory activity, this antibody is a valuable tool for studying mitogen-activated protein (MAP) kinase pathways and their role in various biological processes. Choose the MAP3K8 antibody for reliable and accurate results in your research experiments.</p>

<p>Integrin alpha 7 antibody is a highly specialized monoclonal antibody that targets the integrin alpha 7 protein. This antibody has been extensively studied and proven to be effective in various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The BCL2 antibody is an inhibitory factor used in Life Sciences to study the role of the BCL2 protein in various cellular processes. It interacts with sulphates, taxol, and other molecules to modulate their activity. This antibody targets the tyrosine kinase receptor and fibronectin, playing a crucial role in signal transduction pathways. The BCL2 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Additionally, it has been used to study dopamine signaling, phosphatase activity, and the function of circumsporozoite protein. Its interaction with calpain suggests its involvement in cellular processes such as apoptosis and cell cycle regulation. With its versatility and wide range of applications, the BCL2 antibody is an invaluable tool for researchers in various fields of study.</p>

<p>The CHRNA7 antibody is a highly specialized antibody that targets the CHRNA7 protein, which is involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in research applications.</p>

<p>SERPINB13 antibody was raised in rabbit using residues 310-324 [SEHKADYSGMSSGSG] of the human SERPINB13 protein as the immunogen.</p>

<p>The SDS antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to SDS (sodium dodecyl sulfate), a commonly used solute in various laboratory techniques. This antibody has been extensively tested and proven to be highly specific and sensitive for the detection of SDS.</p>

<p>Purified Polyclonal PI3K p85 beta antibody</p>

<p>GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL</p>

<p>The GFP Tag antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the green fluorescent protein (GFP) tag, which is commonly used as a marker in molecular biology experiments.</p>

<p>LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR</p>

<p>The 4EBP1 antibody is a polyclonal antibody used to detect the presence of 4EBP1 protein. It is produced by immunizing animals with a synthetic peptide corresponding to residues near the carboxy terminus of human 4EBP1 protein. This antibody recognizes both native and recombinant forms of 4EBP1 protein and can be used in various immunoassays, including ELISA, Western blotting, and immunoprecipitation. The 4EBP1 antibody has been used to study the role of this protein in estradiol-induced gonadotropin release from rat pituitary cells and c-myc expression in human chorionic gonadotropin-treated cells. It has also been used to detect serum albumin after methamphetamine administration.</p>

<p>The CD88 antibody is a monoclonal antibody that targets the CD88 glycoprotein. This antibody has been shown to inhibit the growth factor androgen, which is found in human serum. It is commonly used in immunoassays and as a research tool for studying protein kinase inhibitors. The CD88 antibody has also been used to detect autoantibodies and as an electrode in various applications. With its anti-angiogenesis properties, this antibody shows great potential in therapeutic interventions. Whether you need it for research or diagnostic purposes, the CD88 antibody is a reliable tool that delivers accurate and consistent results.</p>

<p>KLHL4 antibody was raised in Rabbit using Human KLHL4 as the immunogen</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATE1 antibody, catalog no. 70R-2257</p>

<p>The HSP60 antibody is a monoclonal antibody that specifically targets heat shock protein 60 (HSP60). This protein is involved in various cellular processes, including protein folding and transport. The HSP60 antibody has been shown to bind to HSP60 in human serum, inhibiting its function and preventing its interaction with other molecules such as fibronectin and TGF-beta. This antibody has also demonstrated cytotoxic effects on cancer cells, making it a potential therapeutic option for cancer treatment. Additionally, the HSP60 antibody can be used in research and diagnostic applications to detect the presence of HSP60 in samples. Its specificity and high affinity make it a valuable tool in the field of life sciences.</p>

<p>Mouse monoclonal TXNRD2 antibody</p>

<p>IL2 antibody was raised in rabbit using highly pure recombinant rat IL-2 as the immunogen.</p>

<p>Recombinant Human CD58 protein</p>

<p>Rabbit polyclonal MRPL40 antibody</p>

<p>Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN</p>

<p>Mouse monoclonal AK5 antibody</p>

<p>Rabbit polyclonal RBL1 antibody</p>

<p>Theophylline antibody was raised in mouse using theophylline-3-BSA as the immunogen.</p>

<p>Rabbit polyclonal ALK antibody (Tyr1096)</p>

<p>CLEC6A antibody was raised using the N terminal of CLEC6A corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK</p>

<p>Monoclonal AFP antibody (Biotin)</p>

<p>Purified recombinant Human CTLA4 protein (His tag)</p>

<p>CABC1 antibody was raised in Rabbit using Human CABC1 as the immunogen</p>

<p>The CD27 antibody is a monoclonal antibody that targets the CD27 protein, which is found on the surface of certain cells in the immune system. This antibody has been shown to have a high affinity for fibronectin and can be used in research and clinical settings to study the role of CD27 in various biological processes. The CD27 antibody can also be used as a tool for detecting and quantifying levels of CD27 in samples. Additionally, this antibody has been used in combination with other antibodies, such as anti-HER2 antibodies, to enhance their therapeutic effects. Overall, the CD27 antibody is a valuable tool for researchers and clinicians working in the field of life sciences.</p>

<p>OVA conjugated Sulfadiazine Hapten</p>

<p>The VEGFR2 antibody is a highly specific monoclonal antibody that targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the process of forming new blood vessels. By binding to VEGFR2, this antibody inhibits the interaction between VEGF and its receptor, thereby preventing the activation of downstream signaling pathways involved in cell proliferation and migration.</p>

<p>OVA conjugated Vitamin B12 Hapten</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques such as patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.</p>

<p>RNH1 antibody was raised in mouse using recombinant Ribonuclease inhibitor 1(RNH1) (7-461aa) purified from E. coli as the immunogen.</p>

<p>cAMP antibody was raised in Mouse using synthetic peptide of cAMP, conjugated to KLH as the immunogen.</p>

<p>Purified recombinant ITGB1BP3 protein (His tag)</p>

<p>HMGB4 antibody was raised in Rabbit using Human HMGB4 as the immunogen</p>

<p>Fentanyl Conjugate for use in immunoassays</p>

<p>Mouse monoclonal V beta 13.1 TCR antibody (FITC)</p>

<p>Purified Recombinant Chimeric Dengue protein</p>

<p>Rabbit polyclonal Tau antibody (Ser404)</p>

<p>Purified Polyclonal DYNC1I2 antibody</p>

<p>SF3B3 antibody was raised using the middle region of SF3B3 corresponding to a region with amino acids TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Atg12 antibody, catalog no. 70R-9658</p>

<p>IRTA1 antibody was raised in rabbit using residues 69-84 [LTPGNTLEVRESGLYR] of the human IRTA1 protein as the immunogen.</p>