Produits biochimiques et réactifs

<p>The GST antibody is a monoclonal antibody that specifically targets glutathione S-transferase (GST). It is widely used in life sciences research and various assays. This antibody can be used to detect the presence of GST in samples, making it a valuable tool for studying the role of GST in cellular processes. Additionally, the GST antibody has been shown to have cytotoxic effects on cancer cells expressing annexin A2, suggesting its potential as a therapeutic agent. With its high specificity and sensitivity, this antibody is an essential component for researchers studying insulin and glucagon signaling pathways, as well as other areas of interest in the field of life sciences.</p>

<p>The Connexin 43 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to Connexin 43, a protein involved in cell-to-cell communication. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>Rabbit polyclonal RM34 antibody</p>

<p>POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML</p>

<p>MAPRE2 antibody was raised in Rabbit using Human MAPRE2 as the immunogen</p>

<p>The PROM2 antibody is a highly specialized monoclonal antibody that targets the collagen protein. It has been extensively studied in the field of Life Sciences for its role in various biological processes. This antibody specifically recognizes and binds to PROM2, a protein that is involved in the regulation of alpha-fetoprotein, globulin, and albumin levels.</p>

<p>The HAO1 antibody is a nuclear autoantibody that belongs to the class of Monoclonal Antibodies. It specifically targets the octanoyltransferase and methyl transferase enzymes, which are involved in high-flux metabolic pathways. This antibody has been extensively studied as a biomarker for various diseases and conditions, including interleukin disorders and carnitine deficiencies. The HAO1 antibody is used in research and diagnostic assays to detect the presence of these enzymes and their inhibitors. Its high specificity and sensitivity make it an essential tool in the field of Life Sciences.</p>

<p>CACNA1I antibody was raised using the middle region of CACNA1I corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS</p>

<p>The Glucagon antibody is a monoclonal antibody that has been developed for use in bioassays and immunoassays. It specifically targets the antigen binding domain of lipoprotein lipase, an enzyme involved in lipid metabolism. This monoclonal antibody is highly reactive and has been extensively studied in Life Sciences research.</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>PSA antibody was raised in mouse using human seminal fluid PSA as the immunogen.</p>

<p>KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4315</p>

<p>ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF</p>

<p>Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogen</p>

<p>Mouse monoclonal MRPS25 antibody</p>

<p>JE MCP1 antibody was raised in rabbit using highly pure recombinant JE(MCP-1) as the immunogen.</p>

<p>The INSR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the insulin receptor (INSR) protein, which plays a crucial role in cellular signaling and glucose metabolism. This antibody can be used to study various aspects of INSR function, including its interaction with other proteins such as telomerase, glucagon, β-catenin, and collagen.</p>

<p>Rabbit Polyclonal eNOS antibody (Ser615)</p>

<p>Purified Rabbit polyclonal OR8H2 antibody</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP</p>

<p>Purified Polyclonal Fibulin 1 antibody</p>

<p>PSMD11 antibody was raised in mouse using recombinant human PSMD11 (1-422aa) purified from E. coli as the immunogen.</p>

<p>KRR1 antibody was raised in Rabbit using Human KRR1 as the immunogen</p>

<p>Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE</p>

<p>RAP1GAP antibody was raised using the middle region of RAP1GAP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA</p>

<p>SLC25A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF</p>

<p>1-197 amino acids: MQRASRLKRE LHMLATEPPP GITCWQDKDQ MDDLRAQILG GANTPYEKGV FKLEVIIPER YPFEPPQIRF LTPIYHPNID SAGRICLDVL KLPPKGAWRP SLNIATVLTS IQLLMSEPNP DDPLMADISS EFKYNKPAFL KNARQWTEKH ARQKQKADEE EMLDNLPEAG DSRVHNSTQK RKASQLVGIE KKFHPDVLEH HHHHH</p>

<p>Purified recombinant Human C4BPB protein (His tag)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE</p>

<p>Purified recombinant DDX39A protein (His tag)</p>

<p>TRPA1 antibody was raised using the middle region of TRPA1 corresponding to a region with amino acids KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL</p>

<p>GPT2 antibody was raised in Rabbit using Human GPT2 as the immunogen</p>

<p>Purified recombinant SSX1 protein (His tag)</p>

<p>TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF</p>

<p>PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE</p>

<p>Purified native Pig Troponin I protein (Skeletal Muscle)</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>MGMT antibody was raised in Rabbit using Human MGMT as the immunogen</p>

<p>Rat monoclonal CD45RB antibody (PE)</p>

<p>Mouse monoclonal SORD antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>The Yellow Fever Virus NS1 protein is a key component in the study of yellow fever virus and its effects on the human body. It has been found to have anti-glial fibrillary acidic properties, meaning it can inhibit the growth of glial cells in the brain. Additionally, it has been shown to interact with various receptors and factors in the body, such as the growth hormone receptor and interleukin-6 inhibitory factor. This protein is often used in research and scientific studies related to yellow fever virus, as well as in the development of diagnostic tests and therapies. Monoclonal antibodies targeting this protein have been developed for use in neutralizing the virus and detecting its presence in human serum. Recombinant forms of this protein are also used for various applications in Life Sciences, including conjugated proteins for specific assays. Overall, the Yellow Fever Virus NS1 protein is a crucial tool for understanding and combating yellow fever virus infections.</p>

<p>Mouse RBC antibody was raised in rabbit using murine erythrocytes as the immunogen.</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIE</p>

<p>Rabbit polyclonal SYT4 antibody</p>

<p>Purified Rabbit polyclonal MOT12 antibody</p>

<p>Rabbit polyclonal MEF2D antibody (Ser444)</p>

<p>The SRR antibody is a monoclonal antibody that is specifically designed for the detection and neutralization of insulin. It is commonly used in research and clinical settings to study hyperinsulinaemic hypoglycaemia, a condition characterized by abnormally high levels of insulin in the blood. The SRR antibody is produced through chemical synthesis or recombinant technology using human insulin as the antigen. It has been extensively validated using techniques such as polymerase chain reaction (PCR) and racemase assays to ensure its specificity and reliability. This monoclonal antibody can be used to detect insulin in various samples, including serum, plasma, and tissue extracts. Additionally, it has been shown to have neutralizing activity against insulin, making it a valuable tool for studying the effects of insulin antibodies and autoantibodies in human insulin preparations. With its high affinity for insulin and ability to recognize specific amino acid residues, the SRR antibody offers precise and accurate results for insulin-related research applications.</p>

<p>The Cry1 antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to the Cry1 protein, which is involved in various cellular processes such as tyrosine phosphorylation and growth factor signaling. This antibody is colloidal gold-conjugated, making it easily detectable in experiments using techniques such as immunohistochemistry or Western blotting.</p>

<p>Affinity purified Goat polyclonal MSR Type 1 antibody</p>

<p>LRRC37A3 antibody was raised using the middle region of LRRC37A3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS</p>

<p>The V5 Tag antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets the V5 epitope tag, which is commonly used in protein research and expression studies. This antibody can be used for various applications such as immunoblotting, immunoprecipitation, and immunofluorescence assays.</p>

<p>Rabbit polyclonal Mcleod Syndrome antibody</p>

<p>Purified Rabbit polyclonal CEP41 antibody</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Rabbit polyclonal SDCG1 antibody</p>

<p>KIF19 antibody was raised in Rabbit using Human KIF19 as the immunogen</p>

<p>Rabbit polyclonal FADD antibody (Ser194)</p>

<p>Purified recombinant HGF protein (His tag)</p>

<p>The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.</p>

<p>Mouse monoclonal SNTA1 antibody</p>

<p>Rabbit polyclonal TNFAIP1 antibody</p>

<p>Mouse monoclonal PECR antibody</p>

<p>KLHDC4 antibody was raised in Rabbit using Human KLHDC4 as the immunogen</p>

<p>Purified recombinant PRKRA protein (His tag)</p>

<p>TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids VSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKE</p>

<p>ZNF547 antibody was raised in rabbit using the N terminal of ZNF547 as the immunogen</p>

<p>Rabbit polyclonal SSX5 antibody</p>

<p>IFITM1 antibody was raised in Rabbit using Human IFITM1 as the immunogen</p>

<p>DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD</p>

<p>SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.</p>

<p>Goat anti-rat IgG (H+L) (Fab'2) (FITC) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>

<p>Rabbit polyclonal LCN2 antibody (biotin)</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>Rabbit polyclonal MEK1 antibody (Ser298)</p>

<p>Rabbit polyclonal C1D antibody (FITC)</p>

<p>The C6 antibody is a highly activated protein that acts as an inhibitor of tumor necrosis factor-alpha (TNF-α). It is widely used in Life Sciences research for its ability to target and neutralize TNF-α, a key player in inflammation and immune response. The C6 antibody has shown promising results in various studies, including its ability to inhibit the binding of TNF-α to its receptors and reduce the production of inflammatory mediators.</p>

<p>Complement C2 antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>Mouse monoclonal GBP2 antibody</p>

<p>The CD80 antibody is a monoclonal antibody that targets the CD80 protein, which plays a crucial role in immune responses. It has been shown to inhibit the interaction between CD80 and its receptors, including CTLA-4 and PD-L1, leading to enhanced T-cell activation and proliferation. This antibody has been used in various studies to investigate the role of CD80 in different biological processes, such as dopamine signaling, growth factor regulation, endothelial cell growth, and cell adhesion through E-cadherin. Additionally, it has been found to modulate actin dynamics and chemokine production. The CD80 antibody has also been studied for its potential therapeutic applications in diseases like cancer and autoimmune disorders. Its unique properties make it a valuable tool for researchers in the field of Life Sciences.</p>

<p>Mouse monoclonal Cytokeratin 10+13 antibody (Prediluted for IHC)</p>

<p>IL3 beta antibody was raised in goat using highly pure recombinant rat IL-3beta as the immunogen.</p>

<p>Rabbit polyclonal CTRO antibody</p>

<p>Rabbit polyclonal PGDH3 antibody (HRP)</p>

<p>PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN</p>

<p>DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP</p>

<p>Rabbit polyclonal ZNF697 antibody</p>

<p>Mouse monoclonal BAIAP2 antibody</p>

<p>The TF antibody is a highly specialized monoclonal antibody that is used for various applications in research and diagnostics. This antibody specifically recognizes the TF antigen, which is a carbohydrate structure found on the surface of cells. The TF antibody can be used in immunoassays, such as ELISA or Western blotting, to detect the presence of TF antigen in samples.</p>

<p>ETV5 antibody was raised in Mouse using a purified recombinant fragment of human ETV5 expressed in E. coli as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>The USP5 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of neutralizing monoclonal antibodies that target TGF-beta protein. This antibody is specifically designed to bind to and neutralize TGF-beta, a growth factor involved in various cellular processes.</p>

<p>The RBP1 antibody is a growth factor that has been shown to play a role in thrombocytopenia. It is commonly used in Life Sciences research and can be utilized in various experimental techniques, such as electrode-based assays. This trifunctional antibody is capable of binding to human serum and activating specific pathways. It can also be used as a tool for the detection and quantification of other antibodies or antigens. The RBP1 antibody has genotoxic effects on cells, making it useful for studying DNA damage and repair mechanisms. Additionally, it acts as an inhibitor of phosphatase activity and chemokine signaling. This Monoclonal Antibody specifically targets tyrosine kinase receptors and protein kinases, making it an essential tool for researchers in the field of molecular biology.</p>