Produits biochimiques et réactifs

<p>The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.</p>

<p>The Androgen Receptor antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying the role of androgen receptors in various biological processes. This polyclonal antibody specifically targets and binds to the androgen receptor, a protein involved in the regulation of gene expression.</p>

<p>Purified Rabbit polyclonal TFII-I antibody (Tyr248)</p>

<p>Mouse monoclonal PPWD1 antibody</p>

<p>Purified Rabbit polyclonal CLASP1 antibody</p>

<p>Mouse monoclonal CD11a antibody</p>

<p>Purified Polyclonal RAB14 antibody</p>

<p>Purified Polyclonal SP3/4 antibody</p>

<p>The JAK2 antibody is a highly specialized monoclonal antibody that targets the JAK2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in inhibiting the activity of JAK2, making it an invaluable tool for researchers in the field of life sciences.</p>

<p>The ID3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to collagen, a crucial component of connective tissues. This glycoprotein plays a vital role in maintaining the structural integrity of various organs and tissues in the body.</p>

<p>Rabbit Polyclonal Mtor antibody (Thr2446)</p>

<p>Mouse monoclonal HDHD2 antibody</p>

<p>WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP</p>

<p>Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII</p>

<p>The LIMK1 antibody is a highly specialized monoclonal antibody that targets the cation channel protein LIMK1. This glycoprotein is found in human serum and plays a crucial role in regulating various cellular processes, including cell growth and differentiation. The LIMK1 antibody specifically binds to LIMK1, inhibiting its activity and preventing it from interacting with other proteins.</p>

<p>The HRP antibody is a highly sought-after product in the field of Life Sciences. It is available as both a monoclonal antibody and polyclonal antibodies. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The BUB1 antibody is a monoclonal antibody used in Life Sciences research. It is commonly used to detect and study β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody can also be used to identify autoantibodies in diseases such as heparin-induced thrombocytopenia and antiphospholipid syndrome. Additionally, the BUB1 antibody has been found to have applications in cancer research, as it can target epidermal growth factor receptors and inhibit their activity. It has also shown promise in combination with other antibodies like trastuzumab (anti-HER2) or interferon for the treatment of certain cancers. With its wide range of applications, the BUB1 antibody is a valuable tool for researchers in various fields of study.</p>

<p>The STAT5A antibody is a highly effective monoclonal antibody that targets the STAT5A protein. It is widely used in various research and clinical applications due to its exceptional efficacy and specificity. This antibody specifically recognizes and binds to the activated form of STAT5A, leading to its neutralization and subsequent inhibition of downstream signaling pathways.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG.</p>

<p>Adipophilin antibody was raised in guinea pig using a synthetic peptide corresponding to residues 1-29 of the N-terminus of human and murine adipophilin as the immunogen.</p>

<p>DUSP23 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Y14 Monoclonal Antibody (HRP)</p>

<p>UGT2A3 antibody was raised using the N terminal of UGT2A3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARK7 antibody, catalog no. 70R-5727</p>

<p>HEBP1 antibody was raised in Rabbit using Human HEBP1 as the immunogen</p>

<p>The Retinoblastoma antibody is a test substance used in Life Sciences research. It is an antibody that specifically targets and binds to the ribosomal protein associated with retinoblastoma, a type of eye cancer. This antibody has been shown to inhibit the activity of kinase kinase, a protein involved in cell growth and division. Additionally, it has inhibitory activity against methyltransferase, an enzyme responsible for DNA methylation. The Retinoblastoma antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunohistochemistry. With its high specificity and inhibitory properties, this antibody is a valuable tool for studying the molecular mechanisms underlying retinoblastoma and related diseases.</p>

<p>Rat monoclonal CD2 antibody (biotin)</p>

<p>STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPI</p>

<p>Purified recombinant rpsD protein (His tag)</p>

<p>Rabbit polyclonal Cathepsin B antibody (FITC)</p>

<p>GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF</p>

<p>Recombinant Human CYTIP protein (His tag)</p>

<p>Purified recombinant THAP7 protein (His tag)</p>

<p>RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY</p>

<p>14-3-3 tau antibody was raised in mouse using recombinant human 14-3-3 tau (1-245aa) purified from E. coli as the immunogen.</p>

<p>Conjugated Benzodiazepine-BSA hapten</p>

<p>RNF144B antibody was raised using the middle region of RNF144B corresponding to a region with amino acids KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG</p>

<p>Mouse monoclonal IFT57 antibody</p>

<p>MYEOV antibody was raised in Rabbit using Human MYEOV as the immunogen</p>

<p>ITGB1BP2 antibody was raised in Rabbit using Human ITGB1BP2 as the immunogen</p>

<p>MAPK8IP2 antibody was raised in Rabbit using Human MAPK8IP2 as the immunogen</p>

<p>GIOT-1 antibody was raised in rabbit using the N terminal of GIOT-1 as the immunogen</p>

<p>Armenian Hamster monoclonal IgG Isotype Control antibody (allophycocyanin)</p>

<p>The Pyruvate Carboxylase antibody is a growth factor that acts as a neuroprotective agent. It belongs to the cytokine family and has DNA binding activity. This antibody is commonly used in the field of Life Sciences for research purposes. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein. The Pyruvate Carboxylase antibody has been shown to inhibit the activity of serine proteases and adenosine A1 receptors. Additionally, it has been found to modulate transmembrane conductance and regulate the expression of leukemia inhibitory factor. Researchers use this antibody to study various cellular processes and investigate its potential therapeutic applications.</p>

<p>GNG4 antibody was raised in Rabbit using Human GNG4 as the immunogen</p>

<p>The CD80 antibody is a monoclonal antibody that specifically targets the CD20 antigen. It is widely used in Life Sciences research to study various cellular processes involving actin filaments. The CD80 antibody binds to actin, a protein involved in cell structure and movement, and can be visualized using phalloidin, a fluorescent compound that specifically binds to actin filaments. This antibody is also commonly used in drug development as a therapeutic agent for targeting cancer cells that overexpress the CD20 antigen. The CD80 antibody has been extensively tested and validated for its specificity and efficacy in various experimental settings, making it a valuable tool for researchers studying actin dynamics and related cellular processes.</p>

<p>Mouse monoclonal anti human BUB3 antibody</p>

<p>Rabbit Polyclonal p47 phox antibody (Ser370)</p>

<p>ENA78 antibody was raised in rabbit using highly pure recombinant human ENA-78 as the immunogen.</p>

<p>Mouse monoclonal PTK2B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ11171 antibody, catalog no. 70R-4076</p>

<p>Rat PMN antibody was raised in rabbit using rat PMNs as the immunogen.</p>

<p>Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF</p>

<p>ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD</p>

<p>Rabbit polyclonal OR2AG antibody</p>

<p>Rabbit polyclonal TBX10 antibody</p>

<p>KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV</p>

<p>Purified Polyclonal PFKFB1/4 antibody</p>

<p>Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL</p>

<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>

<p>PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT</p>

<p>The BAK antibody is a highly reactive monoclonal antibody that targets the growth factor histidine. It is specifically designed to bind to collagen and epidermal growth factor, making it an effective tool for research in the field of Life Sciences. Additionally, this antibody has shown strong binding affinity towards anti-mesothelin, TGF-beta1, steroid, erythropoietin, and glutamate. With its ability to detect and neutralize autoantibodies, the BAK antibody is an invaluable asset for any laboratory or research facility. Trust in its reliability and specificity to enhance your experiments and advance scientific knowledge.</p>

<p>Salmonella typhi Monoclonal Antibody BSA/Azide Free</p>

<p>The CES2 antibody is a polyclonal antibody that is used in immunohistochemistry to detect the presence of CES2 antigen. It can be immobilized on an electrode and activated to bind specifically to CES2 antigen. This antibody has been shown to have high specificity and sensitivity in detecting CES2 expression in various tissues. CES2 is an enzyme that plays a crucial role in drug metabolism, including the activation of prodrugs and the detoxification of xenobiotics. It has also been implicated in interferon signaling and chemokine regulation. The CES2 antibody is widely used in life sciences research to study the function and localization of CES2 protein in different biological systems, including transthyretin-related diseases and CXCR4-mediated processes.</p>

<p>1-134 amino acids: MGSSHHHHHH SSGLVPRGSH MEFVMKQALG GATKDMGKML GGDEEKDPDA AKKEEERQEA LRQAEEERKA KYAKMEAERE AVRQGIRDKY GIKKKEEREA EAQAAMEANS EGSLTRPKKA IPPGCGDEVE EEDESILDTV IKYLPGPLQD MLKK</p>

<p>Purified Polyclonal GPR182 antibody</p>

<p>Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA</p>

<p>Purified Polyclonal Kallikrein 3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting and inhibiting bacterial growth. By binding to DNA-dependent RNA polymerase, this drug prevents transcription and replication, effectively stopping the spread of the infection. Additionally, it has been proven to be highly effective in human erythrocytes through patch-clamp techniques. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its bactericidal activity. With its multifaceted approach to fighting tuberculosis, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a promising solution for patients in need.</p>

<p>TCERG1 antibody was raised in mouse using recombinant Transcription Elongation Regulator 1 (Tcerg1)</p>

<p>MAOA antibody is a monoclonal antibody that specifically targets the enzyme monoamine oxidase A (MAOA). This antibody plays a crucial role in regulating the levels of neurotransmitters such as serotonin, norepinephrine, and dopamine. By binding to MAOA, this antibody inhibits its activity and leads to an increase in the levels of these neurotransmitters.</p>

<p>Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.</p>

<p>The STAT5A antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers studying fatty acid metabolism, as it allows for the detection and analysis of STAT5A protein levels in various biological samples. This monoclonal antibody specifically targets STAT5A, a transcription factor that plays a crucial role in mediating cellular responses to cytokines such as interferon and tumor necrosis factor-alpha (TNF-α). By neutralizing STAT5A activity, this antibody can help researchers gain insights into the regulation of gene expression and signaling pathways involved in immune responses and cell growth.</p>

<p>Mouse monoclonal ANXA4 antibody</p>

<p>Mouse monoclonal DR5 antibody (biotin)</p>

<p>Mouse monoclonal C16orf72 antibody</p>

<p>The RALB antibody is a highly specialized antibody that targets the RALB protein. This protein is involved in various cellular processes, including cell growth, migration, and invasion. The RALB antibody is designed to specifically recognize and bind to the RALB protein, neutralizing its activity.</p>

<p>Rabbit polyclonal MRPL13 antibody</p>

<p>Mouse monoclonal ACSBG1 antibody</p>

<p>The STAT5 antibody is a polyclonal antibody that specifically targets the STAT5 protein. STAT5 is a transcription factor that plays a crucial role in various cellular processes, including cell proliferation, differentiation, and survival. This antibody can be used in immunoassays to detect and quantify the expression of STAT5 in different samples.</p>

<p>The CHRNA7 antibody is a highly specialized antibody that targets the CHRNA7 protein, which is involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in research applications.</p>

<p>SERPINB13 antibody was raised in rabbit using residues 310-324 [SEHKADYSGMSSGSG] of the human SERPINB13 protein as the immunogen.</p>

<p>The SDS antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to SDS (sodium dodecyl sulfate), a commonly used solute in various laboratory techniques. This antibody has been extensively tested and proven to be highly specific and sensitive for the detection of SDS.</p>

<p>Purified Polyclonal PI3K p85 beta antibody</p>

<p>GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL</p>

<p>The GFP Tag antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the green fluorescent protein (GFP) tag, which is commonly used as a marker in molecular biology experiments.</p>

<p>LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR</p>

<p>The 4EBP1 antibody is a polyclonal antibody used to detect the presence of 4EBP1 protein. It is produced by immunizing animals with a synthetic peptide corresponding to residues near the carboxy terminus of human 4EBP1 protein. This antibody recognizes both native and recombinant forms of 4EBP1 protein and can be used in various immunoassays, including ELISA, Western blotting, and immunoprecipitation. The 4EBP1 antibody has been used to study the role of this protein in estradiol-induced gonadotropin release from rat pituitary cells and c-myc expression in human chorionic gonadotropin-treated cells. It has also been used to detect serum albumin after methamphetamine administration.</p>

<p>The CD88 antibody is a monoclonal antibody that targets the CD88 glycoprotein. This antibody has been shown to inhibit the growth factor androgen, which is found in human serum. It is commonly used in immunoassays and as a research tool for studying protein kinase inhibitors. The CD88 antibody has also been used to detect autoantibodies and as an electrode in various applications. With its anti-angiogenesis properties, this antibody shows great potential in therapeutic interventions. Whether you need it for research or diagnostic purposes, the CD88 antibody is a reliable tool that delivers accurate and consistent results.</p>

<p>KLHL4 antibody was raised in Rabbit using Human KLHL4 as the immunogen</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATE1 antibody, catalog no. 70R-2257</p>

<p>The HSP60 antibody is a monoclonal antibody that specifically targets heat shock protein 60 (HSP60). This protein is involved in various cellular processes, including protein folding and transport. The HSP60 antibody has been shown to bind to HSP60 in human serum, inhibiting its function and preventing its interaction with other molecules such as fibronectin and TGF-beta. This antibody has also demonstrated cytotoxic effects on cancer cells, making it a potential therapeutic option for cancer treatment. Additionally, the HSP60 antibody can be used in research and diagnostic applications to detect the presence of HSP60 in samples. Its specificity and high affinity make it a valuable tool in the field of life sciences.</p>

<p>Mouse monoclonal TXNRD2 antibody</p>

<p>IL2 antibody was raised in rabbit using highly pure recombinant rat IL-2 as the immunogen.</p>

<p>Recombinant Human CD58 protein</p>

<p>Rabbit polyclonal MRPL40 antibody</p>

<p>Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN</p>

<p>Mouse monoclonal AK5 antibody</p>