Produits biochimiques et réactifs

<p>Betacellulin antibody was raised in rabbit using highly pure recombinant human betacellulin as the immunogen.</p>

<p>Rabbit polyclonal TFDP2 antibody</p>

<p>1-76 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMLI KVKTLTGKEI EIDIEPTDKV ERIKERVEEK EGIPPQQQRL IYSGKQMNDE KTAADYKILG GSVLHLVLAL RGG</p>

<p>SLC25A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ</p>

<p>PTK2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KCNJ2 antibody was raised in Rabbit using Human KCNJ2 as the immunogen</p>

<p>Purified recombinant IL17F protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF660 antibody, catalog no. 20R-1117</p>

<p>The beta Amyloid antibody is a monoclonal antibody that specifically targets and binds to beta amyloid proteins. It is widely used in the field of Life Sciences for research purposes, particularly in the study of Alzheimer's disease. This antibody has been shown to have a high affinity for beta amyloid, effectively neutralizing its effects and inhibiting its aggregation. By binding to beta amyloid, this antibody prevents the formation of plaques and reduces the levels of toxic beta amyloid in the brain. Additionally, it has been found to modulate the activity of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and neurodegeneration. The beta Amyloid antibody can be used as a valuable tool in understanding the pathogenesis of Alzheimer's disease and developing potential therapeutic interventions.</p>

<p>Rabbit polyclonal SFRS4 antibody</p>

<p>MRE11A antibody was raised in Rabbit using Human MRE11A as the immunogen</p>

<p>TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL</p>

<p>Mouse monoclonal CD11a antibody</p>

<p>Rabbit polyclonal TIA1 antibody</p>

<p>Rabbit polyclonal RNF6 antibody</p>

<p>Mouse monoclonal EPN2 antibody</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>UNC5C antibody was raised using a synthetic peptide corresponding to a region with amino acids WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE</p>

<p>ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET</p>

<p>FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ</p>

<p>The PAK3 antibody is a highly effective cytotoxic agent commonly used in the Life Sciences field. It belongs to the class of Polyclonal Antibodies and is specifically designed to target alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's. This antibody has been extensively tested and proven to inhibit the activity of glucose transporter proteins, which play a crucial role in cellular metabolism. Additionally, the PAK3 antibody acts as a potent inhibitor of protein kinase enzymes involved in cell signaling pathways. Its binding affinity to collagen molecules ensures precise targeting and efficient delivery of therapeutic agents. With its exceptional specificity and high affinity for its target, this monoclonal antibody is an indispensable tool for researchers in various fields. Whether you are studying nuclear signaling or investigating mitogen-activated protein pathways, the PAK3 antibody offers reliable results that can revolutionize your research. Trust in this powerful tool to unlock new insights into complex biological processes.</p>

<p>CRTH2 antibody was raised in rabbit using residues 329-348 [DDSELGGAGSSRRRRTSSTA] of the CRTH2 (GPR44) protein located near the C-terminus as the immunogen.</p>

<p>Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>The ALK antibody is a monoclonal antibody that targets the anaplastic lymphoma kinase (ALK) protein. It is widely used in life sciences research to study various cellular processes and signaling pathways involving ALK. This antibody specifically recognizes and binds to ALK, allowing for its detection and analysis in different experimental settings.</p>

<p>Rabbit polyclonal RAB9B antibody</p>

<p>P2RY8 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GPI antibody was raised in Rabbit using Human GPI as the immunogen</p>

<p>Purified Rabbit polyclonal GNAI3 antibody</p>

<p>Rat mast cells antibody was raised in rabbit using rat mast cells as the immunogen.</p>

<p>Rabbit Polyclonal beta Catenin antibody (Thr41/Ser45)</p>

<p>Human Thyroid Stimulating Hormone</p>

<p>NFKB P65 rel A antibody was raised in rabbit using NFkB p65 (Rel A) peptide corresponding to a region near the C-terminus of the human protein conjugated to KLH as the immunogen.</p>

<p>The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.</p>

<p>Rabbit polyclonal ATN1 antibody</p>

<p>Purified recombinant REXO2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAC1 antibody, catalog no. 70R-3936</p>

<p>Portion of EBV EBNA 3C</p>

<p>The TNNT2 antibody is a highly specialized antibody that targets the troponin T protein in cardiomyocytes. It is available in both polyclonal and monoclonal forms, offering flexibility in research applications. This antibody specifically binds to troponin T, which is involved in regulating muscle contraction in the heart. By targeting this protein, researchers can study various aspects of cardiac function and disease.</p>

<p>The p70S6k antibody is an acidic monoclonal antibody that specifically targets the cysteine disulfide region of the p70S6k protein. It has been widely used in Life Sciences research to study the role of p70S6k in various cellular processes. This antibody has neutralizing activity against oncostatin and natriuretic factors, making it a valuable tool for investigating their signaling pathways. Additionally, the p70S6k antibody has been used as a blood biomarker for ultrasensitive detection of leukemia inhibitory factor in human serum samples. With its high affinity and specificity, this monoclonal antibody is an essential tool for researchers studying the primary amino acid sequence and structure of p70S6k using techniques such as electrode-based assays.</p>

<p>Rabbit polyclonal VEGFR2 antibody (Tyr951)</p>

<p>Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.</p>

<p>Rabbit polyclonal RPAB1 antibody</p>

<p>ALAD antibody was raised in rabbit using the N terminal of ALAD as the immunogen</p>

<p>Rabbit polyclonal Angiogenin antibody (HRP)</p>

<p>The IL17 antibody is a powerful medicament that plays a crucial role in neutralizing the effects of interleukin-17 (IL-17). This antibody is highly effective in targeting and binding to IL-17, thereby inhibiting its activity. IL-17 is a key player in various inflammatory conditions such as collagen-induced arthritis and cytotoxic T lymphocyte-mediated tissue damage. By blocking the action of IL-17, this antibody helps reduce inflammation and prevents tissue damage caused by excessive immune responses. The IL17 antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the role of IL-17 in various disease models. Whether you're conducting experiments or developing therapies, this monoclonal antibody provides reliable results and consistent performance. Trust in the power of antibodies with our high-quality IL17 antibody.</p>

<p>Mouse monoclonal GTF2F1 antibody</p>

<p>Mouse monoclonal SNX9 antibody</p>

<p>CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK</p>

<p>Purified Polyclonal CD49e HC antibody</p>

<p>Avidin protein is a versatile protein that has various characteristics and applications. It is an EGF-like protein that can be used in Proteins and Antigens research. Avidin protein can be tagged with a monoclonal antibody for specific targeting of cells or molecules. It can also bind to vasoactive intestinal peptide, albumin, human serum albumin, and other proteins, making it useful in various biochemical assays.</p>

<p>Rabbit polyclonal TARS antibody</p>

<p>Rabbit polyclonal STK39 antibody (Ser325)</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>SYT2 antibody was raised in rabbit using the C terminal of SYT2 as the immunogen</p>

<p>Rabbit polyclonal NFKB p105/p50 antibody (Ser927)</p>

<p>IFNGR1 antibody was raised in Rabbit using Human IFNGR1 as the immunogen</p>

<p>Purified recombinant RPS20 protein (His tag)</p>

<p>HIV1 gp120 antibody was raised in rabbit using HIV-1 gp120 as the immunogen.</p>

<p>The HDAC10 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to HDAC10, a histone deacetylase enzyme involved in gene expression regulation. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>IFNG antibody was raised in Rabbit using Human IFNG as the immunogen</p>

<p>HAP40 antibody was raised in rabbit using residues 314-325 [DGHGQDTSGQLP] of the 40 kDa mouse HAP40 protein as the immunogen.</p>

<p>MCB-613 is a novel chemotherapeutic agent that targets the primary tumor by interfering with the physiological function of macrophages. This drug inhibits the production of inflammatory cytokines, such as IL-1β and IL-6, which are important for cancer progression. MCB-613 also has anti-proliferative effects in cells, including inhibition of cell cycle progression at G2/M phase and induction of apoptosis. This drug may be useful in the treatment of cancers such as breast cancer, prostate cancer, and lung cancer.</p>

<p>Indanazoline is a molecule that is an analog of indole. It has been used in the treatment of inflammatory bowel disease, although its mechanism of action is not yet known. Indanazoline has been shown to inhibit the growth of bacteria and fungi, as well as being effective in animal experiments for treating bowel disease. This drug also has a number of side effects, including diarrhea and abdominal pain. In addition, indanazoline may cause population growth in animals if given in high doses.</p>

<p>Glutamate is an amino acid that is the major excitatory neurotransmitter in the central nervous system. It is found in many foods and dietary supplements. Glutamic acid may be converted to glutamine by the enzyme glutaminase, and then converted to glutamate again by the enzyme glutaminase. Glutamate is a metabolic intermediate in various biochemical reactions, including synthesis of proteins, lipids, and nucleic acids. Glutamic acid is also used as a food additive and has antimicrobial properties.</p>

<p>1V209 is a vaccine adjuvant that has been shown to stimulate an antitumor response. It is a molecule that binds to toll-like receptor 4 (TLR4) on tumor cells, stimulating TLR4-mediated signaling pathways, which induces the production of death proteins. 1V209 also upregulates PD-L1 expression in tumor cells and activates the immune system to target and kill cancer cells. 1V209 may be used as a cancer therapy or as a vaccine adjuvant against infectious diseases such as hepatitis B, hepatitis C, and human immunodeficiency virus.</p>

<p>Please enquire for more information about Renin inhibitor peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAT-Gap19 is a peptide that has been shown to reduce inflammation and microbial infection in animal models. TAT-Gap19 is an extracellular soluble protein that can enter the cell by endocytosis and activate microglial cells. It also has the ability to inhibit the uptake of fatty acids, which are important for inflammatory responses. TAT-Gap19 can be used as a therapeutic agent for chronic liver injury, osmotic pump, or hypothalamic neurons. TAT-Gap19 also has been shown to inhibit dopamine release from dopaminergic neurons in mice with Parkinson's disease.</p>

<p>Pd-85639 is a synthetic small molecule, which is a product of laboratory-derived chemical synthesis. Its structure mimics certain naturally occurring biomolecules that interact with cellular pathways pivotal in the regulation of cell growth and apoptosis. Specifically, Pd-85639 operates by inhibiting specific enzymes and signaling pathways, leading to the disruption of malignant cell proliferation and induction of programmed cell death.</p>

<p>SB 225002 is an integrin antagonist that inhibits the interaction between neutrophils and cancer cells, thereby preventing cellular transformation. This drug blocks the binding of growth factor-β1 to integrin receptors on the surface of tumor cells, leading to the inhibition of tumor growth and metastasis. SB225002 has been shown to inhibit tumor growth in mice models by blocking a receptor activity and inducing caspase-independent cell death. SB 225002 also inhibits the binding of toll-like receptors (TLRs) to ligands such as lipopolysaccharide (LPS), which leads to less production of inflammatory cytokines and chemokines. SB 225002 has been shown to be effective against a number of different types of cancer cells, including breast, prostate, pancreatic, colon, lung, liver, bladder, and leukemia cells.</p>

<p>PF 06747775 is a growth factor that binds to the epidermal growth factor receptor (EGFR) and toll-like receptor 4 (TLR4), thereby inhibiting their downstream signaling. PF 06747775 has been shown to be effective in treating cancer, inflammatory diseases, and other diseases characterized by uncontrolled cell proliferation. It also inhibits the activity of CDK4/6, which regulates the G0/G1 phase transition in cells. PF 06747775 is administered systemically as a microsphere formulation for oral delivery. The drug is currently in Phase II clinical trials for its potential use as a treatment for cancer and inflammatory diseases.</p>

<p>Inhibitor of SMYD2 methyltransferase</p>

<p>E-7766 is a potent anticancer drug that is derived from urine and has been used in medicinal practices for its kinase inhibitory properties. It is an analog of indirubin, a natural compound found in Chinese herbal medicine. E-7766 induces apoptosis in cancer cells by targeting specific protein kinases, which are essential for cell survival and proliferation. This drug has shown promising results in preclinical studies as an inhibitor of various types of cancer, including breast, lung, and prostate cancer. E-7766 has the potential to be a highly effective therapy for the treatment of multiple cancers due to its ability to selectively target cancer cells while sparing healthy cells. Its unique mechanism of action makes it a valuable addition to the arsenal of anticancer drugs available today.</p>

<p>Gamitrinib is a small molecule that inhibits polymerase chain reaction (PCR) and transcription-quantitative polymerase chain reaction (RT-qPCR). Gamitrinib binds to the polymerase enzyme, blocking DNA replication. It also has anti-tumor effects, inhibiting the growth of skin cancer cells. Gamitrinib blocks mitochondrial functions by binding to the mitochondrial DNA. This drug also has synergistic effects with other cancer drugs, such as temozolomide. Gamitrinib is a competitive inhibitor of ryanodine receptor and blocks mitochondrial membrane potential, leading to cell death.</p>

<p>D-(+)-Sn-1-o-arachidonoyl-glyceryl-3-phosphate, also known as arachidonoyl LPA, is a bioactive lipid molecule that plays an important role in various biological processes. It contains an acyl group that is essential for its biological activity. Arachidonoyl LPA has been shown to regulate the cell cycle and promote cell proliferation in endothelial cells. It is found in plasma at low levels but can be elevated in certain metabolic diseases and cancer. Arachidonoyl LPA has an inhibitory effect on the growth of carcinoma cells and has been identified as an endogenous ligand for the lysophosphatidic acid receptor, which is involved in regulating cell proliferation and migration. As an inhibitor of this receptor, arachidonoyl LPA may have potential therapeutic applications for cancer treatment and other diseases related to abnormal cell growth. Its unique biological activity makes it a valuable tool for studying cellular signaling pathways</p>

<p>(2R,3S)-3-((9-Isopropyl-6-((pyridin-3-ylmethyl)amino)-9H-purin-2-yl)amino)pentan-2-ol is a small molecule that binds to an ion channel receptor. This ligand has been shown to inhibit the activation of these channels by certain neurotransmitters, leading to potential therapeutic applications in diseases such as epilepsy or chronic pain. (2R,3S)-3-((9-Isopropyl-6-(pyridin 3 ylmethyl)amino)-9H purin 2 yl)amino)pentan 2 ol also binds to the GABA receptor with high affinity and specificity. It is a potent inhibitor of chloride currents in neurons and can be used as a research tool for studying protein interactions and mechanisms of action.</p>

<p>Balaglitazone is an antidiabetic agent classified as a thiazolidinedione, which is a synthetic compound derived from pharmaceutical research focused on insulin sensitization. Its mode of action involves selective activation of the peroxisome proliferator-activated receptor gamma (PPARγ), a nuclear receptor that plays a critical role in adipocyte differentiation and glucose metabolism. By modulating the transcription of specific insulin-responsive genes, Balaglitazone enhances insulin sensitivity in peripheral tissues, thus facilitating more effective glucose uptake and utilization.</p>

<p>Rel-(R,S)-formoterol is a medicinal compound that has shown promising results in the inhibition of cancer cell growth. It is derived from Chinese medicinal plants and has been tested on human cancer cell lines. Rel-(R,S)-formoterol works by inhibiting kinase activity, which is involved in regulating the cell cycle and preventing apoptosis. By inhibiting this activity, Rel-(R,S)-formoterol induces apoptosis and leads to cell death in cancer cells. This compound also acts as a protein inhibitor, preventing the formation of protein complexes that are essential for cancer cell survival. In addition, Rel-(R,S)-formoterol has been detected in urine samples of patients undergoing cancer treatment, indicating its potential use as a therapeutic agent.</p>

<p>Please enquire for more information about (Z)-16-(Ethylcarbamoylamino)hexadec-11-enoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ko-3290 is an α/β-adrenergic receptor agonist that can be used as a bronchodilator in the treatment of asthma. Ko-3290 has been shown to decrease blood pressure and increase cardiac output in supine dogs. In addition, it has been shown to stimulate lipolysis and inhibit insulin release. This drug also has the potential to differentiate between species, which is important for the treatment of human patients. The effects of Ko-3290 on metabolic parameters (e.g., serum insulin, fatty acids) are not always consistent across different species, so it is important to monitor these levels when administering this drug to humans.</p>

<p>Rat pan T cell antibody (biotin) was raised in mouse using rat lymphocytes as the immunogen.</p>

<p>Region of Flt Ligand protein corresponding to amino acids TQDCSFQHSP ISSDFAVKIR ELSDYLLQDY PVTVASNLQD EELCGGLWRL VLAQRWMERL KTVAGSKMQG LLERVNTEIH FVTKCAFQPP PSCLRFVQTN ISRLLQETSE QLVALKPWIT RQNFSRCLEL QCQPDSSTLP PPWSPRPLEA TAPTA.</p>

<p>Nocloprost is a synthetic analog of prostaglandin F2α. It is a specific agonist for the prostaglandin receptor, which is found in the epidermal growth factor, protein data, and hematopoietic cells. Nocloprost is taken up by these cells and causes an increase in cytosolic calcium levels. This leads to activation of pancreatic enzymes and hydrochloric acid production. The chemical name for nocloprost is 4-oxo-1-(2-propenyl)-5-(3-phenylpropyl)penta-1,4-dienoic acid methyl ester. The molecular formula is C14H22O3 with a molecular weight of 258.34 g/mol.</p>

<p>GDC-0575 is a potent, selective, and orally available inhibitor of the voltage-gated potassium channel Kv1.3. It has been shown to inhibit Kv1.3 in both native and recombinant systems with an IC50 of less than 1 nM for both channels. GDC-0575 has been shown to have no effect on other voltage-gated ion channels tested, such as Kv2.1 and Kv4.2, which are expressed in many tissues including the brain, heart, and skeletal muscle. GDC-0575 is also selective for Kv1.3 over other closely related ion channels such as Kv4.2 and Shaker B channels (Kv1) with inhibition constants in the low nanomolar range.</p>

<p>Cav 2.2 blocker 1 is a hydroxylated flavonol that is an inhibitor of the Cav 2.2 channel. It has been shown to have potent anthelmintic activity in vitro, and it may also have antiangiogenic properties in vivo. Cav 2.2 blocker 1 has been shown to inhibit the proliferation of HL-60 cells by blocking the apoptosis pathway, and it inhibits the invasion of human hepatoma cells in vitro. The structural analysis of Cav 2.2 blocker 1 revealed that this compound binds to group P2 of the ATP binding site on the Cav 2.2 channel, which is located in a hydrophobic pocket formed by three phenylalanine residues at positions 325, 327, and 329 on subunit A (P325A/P327A/P329A). This binding mode is similar to that observed for other inhibitors of the Cav 2.2 channel such as 3-o-caffeoylquinic acid and N</p>

<p>ICI 89406 is an analytical agent that binds to the 2-adrenergic receptor. Binding of ICI 89406 to this receptor leads to a reduction in the levels of cAMP and activation of protein kinase A, which regulates glucose uptake, thermogenesis, and cardiac function. ICI 89406 has also been shown to bind to guanine nucleotide-binding proteins that regulate binding of GTP, thereby inhibiting transcription-polymerase chain reaction (PCR) activity. This drug has affinity constants for both the heart and adrenal gland tissues. It is selective for the 2-adrenergic receptor and does not bind to other receptors such as those for serotonin or dopamine.</p>

<p>CH5183284 is a monoclonal antibody that binds to the tyrosine kinase domain of the HER2 protein. It has been shown to inhibit angiogenesis in vitro, which may be due to its ability to block epidermal growth factor (EGF) signalling. This drug also inhibits EGF-induced migration of prostate cancer cells and skin cancer cells in vitro. CH5183284 has potential as a biomarker for tumours that overexpress HER2, as well as being a potential target for cancer therapy.</p>

<p>Lifirafenib is a potent and selective kinase inhibitor, which is synthetically derived. It operates by targeting and inhibiting specific pathways involving the RAF kinases within the MAPK/ERK signaling cascade. This interruption is critical in the control of cellular proliferation and survival, pathways often dysregulated in various cancers. Lifirafenib is particularly effective against BRAF-mutant cancers, including melanoma and certain types of thyroid and colorectal cancers.</p>

<p>Galactosyl cholesterol is a synthetic compound with anticancer and anti-inflammatory properties. Galactosyl cholesterol has been shown to inhibit lipoprotein lipase (LPL), which is an enzyme that hydrolyzes triglycerides into glycerol and fatty acids. This inhibition prevents the hydrolysis of cholesterol esters, leading to the accumulation of glycoconjugates in tissues. Galactosyl cholesterol also inhibits cancer cells by interfering with the uptake of glucose and glycogen, inhibiting glycolysis, and disrupting protein synthesis.</p>

<p>Simfibrate is a peptide that is an inhibitor of protein interactions. It has been shown to inhibit the binding of proteins to their receptors, and may be used as a research tool in the study of receptor-ligand interactions. Simfibrate also activates some receptors by binding to them.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>(2S)-N-[(4-Carbamimidoylphenyl)methyl]-1-(3-cyclopentylpropanoyl)pyrrolidine-2-carboxamide is a research tool that inhibits ion channels. It is an inhibitor of ligand-gated ion channels and voltage-gated ion channels. This compound binds to a receptor site in the channel and prevents ions from passing through the channel. It has been shown to inhibit ligand-gated ion channels such as nicotinic acetylcholine receptors, serotonin receptors, and GABA receptors. (2S)-N-[(4-Carbamimidoylphenyl)methyl]-1-(3-cyclopentylpropanoyl)pyrrolidine-2-carboxamide also inhibits voltage gated ion channels such as calcium, sodium, potassium, and chloride channels. This compound can be used in pharmacology studies to explore the structure of ligand</p>

<p>Hdhodh-in-1 is an advanced analytical tool designed for conducting multidimensional data analysis, which is sourced from integrative computational methodologies. With a focus on high-dimensional datasets, it operates through a sophisticated algorithm that efficiently processes and integrates various data types, including genomic, proteomic, and metabolomic information.</p>

<p>M 1145 is a monoclonal antibody, which is derived from a highly specific and engineered immunoglobulin source. Its mode of action involves targeting and modulating specific immune cell receptors, disrupting signaling pathways that are critical for the activation and proliferation of these cells. As a result, it can effectively modulate immune responses, making it a promising candidate for therapeutic applications in autoimmune diseases and certain types of cancers.</p>

<p>Rabbit polyclonal ELOA2 antibody</p>

<p>PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM</p>

<p>Rat monoclonal CD244.2 antibody (FITC)</p>

<p>Purified recombinant EXOSC3 protein (His tag)</p>

<p>Az7550 hydrochloride is a research tool for the study of ion channels and receptor interactions. It is a ligand that binds to the peptide receptor site on the cell membrane and activates the channel, leading to an influx of ions into the cell. Az7550 hydrochloride has been shown to activate potassium channels by binding to their ligand-binding site.<br>Az7550 hydrochloride has also been used as an antibody labeling agent for immunofluorescence staining.</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr493)</p>

<p>PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK</p>