Produits biochimiques et réactifs

<p>VLDL protein is a monoclonal antibody that belongs to the category of Proteins and Antigens. It is commonly used in Life Sciences research and has various applications. VLDL protein has been shown to have colony-stimulating properties, promoting the growth and development of cells. It also plays a role in human serum by interacting with other molecules such as epidermal growth factor. Additionally, VLDL protein can neutralize autoantibodies, which are antibodies that target the body's own tissues. This monoclonal antibody can also interact with calmodulin and phosphatase, two important proteins involved in cellular signaling pathways. Furthermore, VLDL protein is associated with low-density lipoproteins (LDL) and can influence their levels in the blood. Overall, VLDL protein is a versatile molecule with diverse functions in biological systems.</p>

<p>The SMS antibody is a powerful tool in the field of Life Sciences. It is an anti-EGFR (epidermal growth factor receptor) antibody that specifically targets the activated form of EGFR. This antibody has been extensively studied and proven to be effective in inhibiting the activity of EGFR, which plays a crucial role in various cellular processes including cell growth, proliferation, and survival.</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>

<p>Mouse monoclonal HLAABC antibody (biotin)</p>

<p>Rabbit polyclonal SPRR3 antibody</p>

<p>Purified Polyclonal Cytochrome P450 1A1/2 antibody</p>

<p>The ACO2 antibody is a highly specific monoclonal antibody that binds to ACO2, an enzyme involved in the tricarboxylic acid cycle. This antibody has been extensively studied and validated for its use in various research applications in the field of life sciences. It can be used for the detection and quantification of ACO2 in human hepatocytes, as well as for studying the role of ACO2 in cellular processes such as metabolism and energy production. The ACO2 antibody has also been shown to interact with other binding proteins, including interferon and chemokine receptors such as CXCR4. Its immobilization on electrodes allows for efficient detection and analysis of ACO2 levels in biological samples, making it a valuable tool for researchers working in the fields of molecular biology and biochemistry.</p>

<p>Rabbit polyclonal FOXH1 antibody</p>

<p>Mouse monoclonal TOM70 antibody</p>

<p>Turkey RBC antibody (Texas Red) was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>The GATA4 antibody is a highly specific and targeted molecule drug that plays a crucial role in the field of Life Sciences. It is known to regulate various processes such as fatty acid metabolism, insulin production, and plasma levels. This antibody is designed to bind to GATA4, a transcription factor involved in the regulation of gene expression.</p>

<p>FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL</p>

<p>NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV</p>

<p>Purified Rabbit polyclonal PECAM1 antibody (Tyr713)</p>

<p>The TFAP2A antibody is a monoclonal antibody that targets the transcription factor AP-2 alpha (TFAP2A). This antibody is commonly used in Life Sciences research to study the role of TFAP2A in various cellular processes. TFAP2A is known to regulate the expression of genes involved in fatty acid metabolism, epidermal growth factor signaling, and cell proliferation. The TFAP2A antibody specifically recognizes and binds to TFAP2A, allowing researchers to investigate its function and localization within cells. This antibody can be used in techniques such as immunofluorescence, immunohistochemistry, and Western blotting to detect and analyze TFAP2A expression levels. With its high specificity and sensitivity, the TFAP2A antibody is an invaluable tool for studying the intricate mechanisms of gene regulation and cellular processes mediated by TFAP2A.</p>

<p>Rabbit polyclonal MAK antibody (Tyr159)</p>

<p>The BRCA1 antibody is a highly specialized cytotoxic agent used in life sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody specifically targets the BRCA1 protein, which is involved in DNA repair and maintenance of genomic stability. By binding to BRCA1, the antibody disrupts its function, leading to cell death.</p>

<p>MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE</p>

<p>The PDIA4 antibody is a monoclonal antibody used in life sciences research. It is specifically designed to target and neutralize PDIA4, a protein involved in various cellular processes. This antibody has been shown to have a significant impact on mesenchymal stem cells and endothelial growth, making it a valuable tool for studying these cell types. Additionally, the PDIA4 antibody can be used in techniques such as immunofluorescence and immunohistochemistry to detect the presence of PDIA4 in biological samples. Its high specificity and sensitivity make it an ideal choice for researchers working with PDIA4-related studies.</p>

<p>ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS</p>

<p>Purified recombinant Human KRT19 protein (His tag)</p>

<p>SOX17 antibody was raised in rabbit using the C terminal of SOX17 as the immunogen</p>

<p>The GPR34 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the GPR34 antigen, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to sclerostin, collagen, and other nuclear proteins.</p>

<p>Rat monoclonal Granzyme B antibody (biotin)</p>

<p>The CHK1 antibody is a polyclonal antibody that specifically targets the hyaluronan receptors. It is widely used in life sciences research for the immobilization and detection of biomolecules. This antibody has been shown to be highly effective in detecting and quantifying mesenchymal stem cells that are activated. The CHK1 antibody can also be used in various applications such as chromatographic and colloidal assays. Additionally, this monoclonal antibody has cytotoxic properties and has been proven to effectively target collagen in blood plasma samples. With its high specificity and sensitivity, the CHK1 antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>Rabbit polyclonal GPR156 antibody</p>

<p>The MDM2 antibody is a highly activated antibody used in Life Sciences research. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. By binding to MDM2, this antibody inhibits its function and prevents it from interacting with other proteins involved in cell signaling pathways.</p>

<p>ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS</p>

<p>The Histone H4 antibody is a growth factor monoclonal antibody that specifically binds to histone H4 proteins. It is widely used in Life Sciences research for various applications, including studying chromatin structure, gene regulation, and epigenetics. This antibody has the ability to neutralize histone H4 binding proteins and can be used to investigate their function. Additionally, the Histone H4 antibody has been shown to have reactive properties, making it an ideal tool for detecting histone H4 modifications and protein-protein interactions. Its high specificity and sensitivity make it a valuable tool for researchers working on anticancer agents, interferon signaling pathways, chemokine biology, antiviral responses, cytotoxicity studies, and multidrug resistance mechanisms. With its versatility and reliability, the Histone H4 antibody is an essential component of any research arsenal in the field of Life Sciences.</p>

<p>Mouse monoclonal Episialin antibody</p>

<p>KLHL5 antibody was raised in rabbit using the N terminal of KLHL5 as the immunogen</p>

<p>The NMT2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has the ability to neutralize multidrug resistance and inhibit the growth of hormone peptides. It targets lipase enzymes, including lipoprotein lipase, and has cytotoxic effects on adipose cells. Additionally, the NMT2 antibody has been shown to have natriuretic properties and can neutralize transforming growth factor-beta (TGF-beta). With its potent antibiotic activity and specificity, this monoclonal antibody is an invaluable asset in various research applications.</p>

<p>Purified recombinant ZG16 protein (His tag)</p>

<p>Rabbit polyclonal MIA2 antibody</p>

<p>RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI</p>

<p>The Haloperidol antibody is a nuclear monoclonal antibody that targets the tyrosine protein complex. It has been specifically designed to neutralize the effects of Haloperidol, a commonly used antipsychotic medication. This antibody binds to the target protein, preventing its interaction with other molecules and inhibiting its activity. The Haloperidol antibody has been extensively tested and validated for use in various applications, including research in life sciences. It is produced using high-quality excipients and inhibitors to ensure stability and efficacy. Additionally, this antibody has shown promising results in studies involving insulin-like growth factor binding proteins, fibronectin, collagen, and low-density lipoprotein receptors. With its specificity and reliability, the Haloperidol antibody is a valuable tool for researchers in the field of multidrug therapy.</p>

<p>Mouse monoclonal ARL11 antibody</p>

<p>Rabbit Polyclonal LENG8 antibody</p>

<p>Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>The PKD2 antibody is a monoclonal antibody that specifically targets potassium channels. It is used in life sciences research to study the role of these channels in various cellular processes. The PKD2 antibody has been shown to neutralize oxidative damage by binding to specific epitopes on the protein. This antibody can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry. The PKD2 antibody is highly reactive and exhibits high specificity towards its target. Its binding affinity allows for accurate detection and quantification of the protein of interest. Researchers can rely on this antibody to provide reliable and reproducible results in their experiments.</p>

<p>ADD3 antibody was raised in rabbit using the C terminal of ADD3 as the immunogen</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMPP VGGKKAKKGI LERLNAGEIV IGDGGFVFAL EKRGYVKAGP WTPEAAVEHP EAVRQLHREF LRAGSNVMQT FTFYASEDKL ENRGNYVLEK ISGQEVNEAA CDIARQVADE GDALVAGGVS QTPSYLSCKS ETEVKKVFLQ QLEVFMKKNV DFLIAEYFEH VEEAVWAVET LIASGKPVAA TMCIGPEGDL HGVPPGECAV RLVKAGASII GVNCHFDPTI SLKTVKLMKE GLEAARLKAH LMSQPLAYHT PDCNKQGFID LPEFPFGLEP RVATRWDIQK YAREAYNLGV RYIGGCCGFE PYHIRAIAEE LAPERGFLPP ASEKHGSWGS GLDMHTKPWV RARARKEYWE NLRIASGRPY NPSMSKPDGW GVTKGTAELM QQKEATTEQQ LKELFEKQKF KSQ</p>

<p>CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR</p>

<p>Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP50 antibody, catalog no. 70R-3057</p>

<p>UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW</p>

<p>Rabbit polyclonal SNX9 antibody</p>

<p>Heparin Binding Protein (HBP) is a medicament that belongs to the category of proteins and antigens in the field of life sciences. It is a growth factor that plays a crucial role in various biological processes. HBP has been studied extensively for its potential therapeutic applications, particularly in mucopolysaccharidosis type disorders.</p>

<p>Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR</p>

<p>Purified recombinant CD33 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC730270 antibody, catalog no. 20R-1271</p>

<p>Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.</p>

<p>Purified recombinant MMP28 protein (His tag)</p>

<p>Salbutamol-BSA is a protein and antigen conjugate that is commonly used in research and laboratory settings. It is an acidic compound that has been conjugated with bovine serum albumin (BSA). Salbutamol-BSA can be used as a tool to study various biological processes, such as the binding of chemokines, epidermal growth factors, or monoclonal antibodies to specific cell antigens. It can also be used in immunoassays to detect the presence of specific proteins or antigens.</p>

<p>Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.</p>

<p>The Androgen Receptor antibody is a highly specific antibody that targets the androgen receptor, a key molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study and understand the role of androgens in different cellular pathways.</p>

<p>Rabbit polyclonal SRP68 antibody</p>

<p>The ITGB1 antibody is a highly specialized monoclonal antibody that targets the human serum and interferon. It is designed for use in Life Sciences research, particularly in the field of apoptosis-inducing factors. This antibody has been developed using advanced techniques, including magnetic particles and expression plasmids. It specifically binds to metal-binding proteins and necrosis factor-related apoptosis-inducing markers, making it a valuable tool for studying cell death pathways. Additionally, the ITGB1 antibody has shown potential as an erbb2 inhibitor and tnf-related apoptosis-inducing agent. Its multispecific nature allows for versatile applications in various research settings.</p>

<p>GPR149 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Lcn2 protein is a conjugated protein that functions as a chemokine and growth factor. It plays a role in various biological processes, including heparin-induced thrombocytopenia and endothelial growth. Lcn2 protein has been shown to be activated by oncostatin and interferon, and it also neutralizes the effects of TNF-α. This protein is commonly used in life sciences research and can be detected using monoclonal antibodies. It is often included as an ingredient in formulations with other excipients for stability and efficacy.</p>

<p>The USP5 antibody is a highly specific monoclonal antibody that targets glycan structures on chimeric proteins. It has been extensively used in the field of Life Sciences for various applications, including the detection and quantification of interferon levels in human serum. This antibody exhibits high affinity and specificity towards its target, making it a valuable tool for research and diagnostic purposes.</p>

<p>MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR</p>

<p>BRAF antibody is a highly specialized monoclonal antibody that targets the BRAF protein, which plays a crucial role in cell signaling pathways. This antibody specifically binds to the activated form of BRAF, inhibiting its activity and preventing downstream signaling events. It has been extensively studied and proven to be effective in various research areas, particularly in the field of Life Sciences.</p>

<p>SH3GL2 antibody was raised using the middle region of SH3GL2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD</p>

<p>Rabbit polyclonal Dynamin 1 antibody</p>

<p>56-239 amino acids: MASMTGGQQM GRGSMAVPIA QKSEPHSLSS EALMRRAVSL VTDSTSTFLS QTTYALIEAI TEYTKAVYTL TSLYRQYTSL LGKMNSEEED EVWQVIIGAR AEMTSKHQEY LKLETTWMTA VGLSEMAAEA AYQTGADQAS ITARNHIQLV KLQVEEVHQL SRKAETKLAE AQIEELRQKT QEEGEERAES EQEAYLRED</p>

<p>The PPP1R15A antibody is a highly specific monoclonal antibody that targets the protein PPP1R15A. This protein plays a crucial role in cellular processes such as collagen synthesis and response to oncostatin. The antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal EPHX2 antibody</p>

<p>Purified Rabbit polyclonal RAD51 antibody (Tyr315)</p>

<p>CDH2 antibody was raised in Mouse using a purified recombinant fragment of human CDH2 expressed in E. coli as the immunogen.</p>

<p>Goat anti-Rabbit IgG (H+L) secondary antibody (PolyCompHRP); 1 mg/ml</p>

<p>The p73 antibody is a highly specialized monoclonal antibody that binds to specific proteins in human hepatocytes. It is commonly used in Life Sciences research to study the function and expression of these proteins. This antibody can also be used in various applications, such as immunohistochemistry and Western blotting, to detect the presence of target proteins in biological samples. The p73 antibody has shown high specificity and sensitivity, making it an ideal tool for studying protein interactions and signaling pathways. Whether you are conducting basic research or developing new therapies, this antibody is an essential tool for understanding cellular processes and disease mechanisms. Trust the p73 antibody to provide accurate and reliable results for your scientific endeavors.</p>

<p>PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT</p>

<p>Armenian Hamster monoclonal CD29 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal STK10 antibody</p>

<p>Artemin antibody was raised in rabbit using highly pure recombinant human artemin as the immunogen.</p>

<p>ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL</p>

<p>Rabbit polyclonal RRS1 antibody</p>

<p>DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids  AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ</p>

<p>Topiramate is an anticonvulsant drug that is used for the control of seizures and in the prophylaxis and treatment of migraines. This drug increases GABA activity and inhibits glutamate activity, therefore blocking neuronal excitability. This leads to a prevention in seizures and migraines.</p>

<p>The PPM1B antibody is a highly specific monoclonal antibody that targets the cell antigen PPM1B. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to neutralize the activity of epidermal growth factor (EGF) and hepatocyte growth factor (HGF), both of which play crucial roles in cell growth and development. Additionally, the PPM1B antibody has been shown to inhibit the multidrug resistance protein, which is responsible for drug resistance in cancer cells.</p>

<p>LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE</p>

<p>ZNF579 antibody was raised in rabbit using the middle region of ZNF579 as the immunogen</p>

<p>Purified native Porcine Porcine Liver Esterase protein</p>

<p>SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE</p>

<p>IDH1 antibody was raised in Rabbit using Human IDH1 as the immunogen</p>

<p>Purified Polyclonal NFYA antibody</p>

<p>1-79 amino acids: MASMTGGQQM GRGSHMAHKQ IYYSDKYFDE HYEYRHVMLP RELSKQVPKT HLMSEEEWRR LGVQQSLGWV HYMIHEPEPH ILLFRRPLPK DQQK</p>

<p>Rat monoclonal Blimp1 antibody</p>

<p>Rabbit Polyclonal OR4K14 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF</p>

<p>Rabbit polyclonal STX11 antibody</p>

<p>AES antibody was raised in rabbit using the middle region of AES as the immunogen</p>

<p>Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA</p>

<p>The Kv1.3 antibody is a potent and highly specific antibody that targets the potassium channels in the body. It has been extensively studied and proven to be effective in various applications within the field of life sciences. This antibody specifically binds to the Kv1.3 channel, which plays a crucial role in regulating cellular functions such as membrane potential and calcium signaling.</p>

<p>Mouse monoclonal CD38 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4A1 antibody, catalog no. 70R-4514</p>

<p>Mouse monoclonal CD45.2 antibody (PE)</p>