Produits biochimiques et réactifs

<p>The EEF2 antibody is a monoclonal antibody that specifically targets vascular endothelial growth factor (VEGF). It has been shown to effectively inhibit the activity of VEGF, a protein involved in angiogenesis and tumor growth. The EEF2 antibody has been extensively studied in various research fields, including Life Sciences and oncology. It has demonstrated its efficacy in inhibiting the proliferation of cancer cells, particularly in breast cancer cell lines such as MCF-7. Additionally, this antibody has been used to study the activation of fibrinogen and protein kinase pathways in different cellular contexts. Its high specificity and affinity make it a valuable tool for researchers studying VEGF-related processes and developing targeted therapies.</p>

<p>Rabbit polyclonal RASGEF1A antibody</p>

<p>GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA</p>

<p>Rabbit polyclonal ACTA1 antibody (biotin)</p>

<p>Bacitracin Conjugate for use in immunoassays</p>

<p>The Cyclin B1 antibody is a monoclonal antibody that specifically targets and binds to Cyclin B1, a protein involved in cell cycle regulation. This antibody is commonly used in Life Sciences research for various applications such as immunohistochemistry, western blotting, and flow cytometry. It has been shown to be highly specific and sensitive in detecting Cyclin B1 expression in different tissues and cell types. The Cyclin B1 antibody can also be used for studying the role of Cyclin B1 in diseases like cancer, where abnormal cell cycle regulation is often observed. With its high affinity and neutralizing properties, this antibody is a valuable tool for researchers studying cell signaling pathways and developing potential therapeutic inhibitors targeting Cyclin B1.</p>

<p>HOXC4 antibody was raised in Rabbit using Human HOXC4 as the immunogen</p>

<p>The Rabbit IgG Heavy Chain antibody is a pluripotent stem cell-derived antibody that plays a crucial role in various biological processes. It specifically targets the heavy chain of rabbit immunoglobulin G (IgG) and can be used as a powerful tool in research and diagnostic applications.</p>

<p>Desmoglein 3 antibody is a polyclonal antibody that specifically targets the desmoglein 3 protein. Desmoglein 3 is a component of desmosomes, which are intercellular junctions involved in cell adhesion. This antibody can be used in various research applications, including immunohistochemistry and western blotting, to study the expression and function of desmoglein 3 in different tissues and cell types.</p>

<p>FXR2 antibody was raised using the middle region of FXR2 corresponding to a region with amino acids RGRRTGGPAYGPSSDVSTASETESEKREEPNRAGPGDRDPPTRGEESRRR</p>

<p>KRT19 antibody was raised in Rabbit using Human KRT19 as the immunogen</p>

<p>Purified Recombinant Cadherin 5 protein (His tagged)</p>

<p>Human Albumin antibody (Alk Phos)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC19 antibody, catalog no. 70R-6343</p>

<p>TADA2L antibody was raised in rabbit using the C terminal of TADA2L as the immunogen</p>

<p>Mouse monoclonal IFN gamma antibody (FITC)</p>

<p>SPINK1 antibody was raised using the N terminal of SPINK1 corresponding to a region with amino acids KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG</p>

<p>Mouse monoclonal IgM antibody (biotin)</p>

<p>Rabbit polyclonal DOCK1 antibody</p>

<p>Purified Polyclonal STAT4 antibody</p>

<p>Purified recombinant MMP1 protein (His tag)</p>

<p>Rabbit polyclonal CST9L antibody</p>

<p>Mouse monoclonal STAT4 antibody</p>

<p>PDIA6 antibody was raised using the middle region of PDIA6 corresponding to a region with amino acids KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA</p>

<p>MYB antibody was raised in Rabbit using Human MYB as the immunogen</p>

<p>Nesprin 2 Antibody</p>

<p>Mouse monoclonal HHEX antibody</p>

<p>The Claudin 4 antibody is a monoclonal antibody that specifically targets the Claudin 4 protein. This protein is found in various tissues and plays a crucial role in cell adhesion and tight junction formation. The Claudin 4 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>The CREM antibody is a monoclonal antibody that specifically targets autoantibodies found in human serum. It is designed to bind to these autoantibodies and neutralize their effects. The CREM antibody has been extensively tested and shown to be highly effective in reducing the levels of autoantibodies in the bloodstream.</p>

<p>The UBASH3B antibody is a high-flux autoantibody that has significant implications in the field of medicine. This monoclonal antibody is widely recognized in the Life Sciences industry for its ability to target and bind to methyl transferase enzymes. As a result, it exhibits potent antiviral properties and plays a crucial role in immune response regulation.</p>

<p>Purified recombinant YIF1B protein (His tag)</p>

<p>Purified recombinant FAM84B protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has shown its high potency using a patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>FTL antibody was raised using the middle region of FTL corresponding to a region with amino acids ALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPE</p>

<p>Mouse anti-Human Alpha-1-microglobulin protein monoclonal antibody</p>

<p>HERC4 antibody was raised using the middle region of HERC4 corresponding to a region with amino acids LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL</p>

<p>Rabbit Polyclonal MAP4 antibody</p>

<p>LY2409881 trihydrochloride is a small molecule inhibitor, which is synthetically derived through chemical processes. It functions as a selective inhibitor of IKKβ (IκB kinase β), an enzyme involved in the NF-κB signaling pathway. By inhibiting IKKβ, LY2409881 effectively impedes the phosphorylation and subsequent degradation of IκB, resulting in the suppression of NF-κB activity.</p>

<p>Rabbit polyclonal Catenin beta antibody (Ser37)</p>

<p>Rabbit polyclonal TTC4 antibody</p>

<p>The CX3CR1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets androgen receptors, which play a crucial role in various biological processes. This antibody has been extensively studied for its ability to detect alpha-fetoprotein, arginase, and other proteins involved in glycosylation. It is commonly used to study autoantibodies and their interactions with glycan structures on glycopeptides. Additionally, the CX3CR1 antibody has been shown to have high affinity for lysozyme, a glycoprotein found in human serum. Its specificity and sensitivity make it an invaluable tool for researchers studying protein-glycan interactions and glycosylation processes.</p>

<p>Mouse monoclonal SORD antibody</p>

<p>Purified recombinant UPRT protein (His tag)</p>

<p>Rabbit polyclonal PLCG1 antibody</p>

<p>PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT</p>

<p>ASF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH</p>

<p>The Hepatitis C Virus protein is a complex protein that exhibits cytotoxic and neutralizing properties. It interacts with various receptors, including the mineralocorticoid receptor, and undergoes glycosylation. This protein is of great interest in the field of Life Sciences and is commonly used in research studies. Monoclonal antibodies targeting the Hepatitis C Virus protein have been developed for diagnostic and therapeutic purposes. The protein has also been studied in relation to its interaction with other biomolecules such as oral haloperidol, teriparatide, dopamine, interferon, and ornithine. Recombinant Proteins &amp; Antigens derived from the Hepatitis C Virus protein are widely used in laboratory settings for various applications.</p>

<p>MORC3 antibody was raised using the N terminal of MORC3 corresponding to a region with amino acids KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT</p>

<p>Purified recombinant CYB5R2 protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections and acts as an active compound in the treatment. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal GRIN2A antibody</p>

<p>GRB7 antibody was raised in Rabbit using Human GRB7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-1477</p>

<p>Purified recombinant RPS18 protein (His tag)</p>

<p>Goat anti-monkey IgM (FITC) was raised in goat using monkey IgM as the immunogen.</p>

<p>Rabbit polyclonal ENPP6 antibody</p>

<p>Purified Polyclonal Cytokeratin 13 antibody</p>

<p>KNG1 antibody was raised in Rabbit using Human KNG1 as the immunogen</p>

<p>GPR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant MED21 protein (His tag)</p>

<p>The OAT antibody is a highly versatile and powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets the Organic Anion Transporter (OAT). This transporter plays a crucial role in the transport of various molecules, including growth factors, glucagon, insulin, and carbonyl groups. The OAT antibody can be used to study the expression and localization of OAT in different tissues and cell types.</p>

<p>Synaptopodin antibody was raised in mouse using Isolated rat kidney glomeruli as the immunogen.</p>

<p>Ntrk2 protein is a crucial protein involved in various biological processes. It has been shown to interact with angptl3, interferon, and other molecules in human serum. The detection of Ntrk2 protein can be achieved using techniques such as hybridization or monoclonal antibody-based assays. Life Sciences offers a range of products for the study of Ntrk2 protein, including streptavidin-conjugated proteins and antigens. These products are designed to provide accurate and reliable results in research settings. To ensure optimal performance, it is recommended to handle and store these products according to the provided instructions. With its high-quality standards and expertise in the field, Life Sciences is a trusted source for Ntrk2 protein-related products.</p>

<p>XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN</p>

<p>RRP1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBQLN4 antibody, catalog no. 70R-3308</p>

<p>1-425 amino acids: MGSSHHHHHH SSGLVPRGSH MSSILPFTPP IVKRLLGWKK GEQNGQEEKW CEKAVKSLVK KLKKTGQLDE LEKAITTQNV NTKCITIPRS LDGRLQVSHR KGLPHVIYCR LWRWPDLHSH HELRAMELCE FAFNMKKDEV CVNPYHYQRV ETPVLPPVLV PRHTEIPAEF PPLDDYSHSI PENTNFPAGI EPQSNIPETP PPGYLSEDGE TSDHQMNHSM DAGSPNLSPN PMSPAHNNLD LQPVTYCEPA FWCSISYYEL NQRVGETFHA SQPSMTVDGF TDPSNSERFC LGLLSNVNRN AAVELTRRHI GRGVRLYYIG GEVFAECLSD SAIFVQSPNC NQRYGWHPAT VCKIPPGCNL KIFNNQEFAA LLAQSVNQGF EAVYQLTRMC TIRMSFVKGW GAEYRRQTVT STPCWIELHL NGPLQWLDKV LTQMGSPSIR CSSVS</p>

<p>RAD antibody is a polyclonal antibody that specifically targets vascular endothelial growth factor (VEGF). It is widely used in life sciences research to study the role of VEGF in angiogenesis and tumor growth. This antibody binds to activated VEGF receptors and inhibits their signaling, thereby blocking the growth and proliferation of endothelial cells. RAD antibody also shows cross-reactivity with other growth factors such as erythropoietin and epidermal growth factor. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and affinity, RAD antibody is a valuable tool for investigating the mechanisms of angiogenesis and developing antiangiogenic therapies.</p>

<p>The Nucleophosmin antibody is a highly reactive antibody that specifically targets nucleophosmin, a protein found in human serum. This antibody has been extensively studied and shown to have various applications in life sciences research. It can be used for the detection of nucleophosmin in different biological samples and has been validated for use in techniques such as Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal GPR174 antibody</p>

<p>Mouse monoclonal HAGHL antibody</p>

<p>ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Sheep polyclonal Acepromazine antibody</p>

<p>IVD antibody was raised in Rabbit using Human IVD as the immunogen</p>

<p>Purified Polyclonal CYP11B1 antibody</p>

<p>GPR6 antibody was raised using the N terminal of GPR6 corresponding to a region with amino acids NASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGAN</p>

<p>Mouse monoclonal CD45RA antibody (biotin)</p>

<p>Purified recombinant ZNF689 protein (His tag)</p>

<p>Alpha synuclein antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 116-131 of the c-terminus of human alpha-synuclein protein as the immunogen.</p>

<p>Rabbit Polyclonal FOXR1 antibody</p>

<p>The p21 antibody is a chemokine that is widely used in immunoassays. It belongs to the class of polyclonal antibodies and is commonly used as a medicament in various applications. This antibody has been shown to have reactive and neutralizing properties, making it highly effective in targeting specific antigens. It is often used in research involving mesenchymal stem cells and cardiomyocytes, where it plays a crucial role in studying their functions and interactions. The p21 antibody is also used in the detection and measurement of various substances, such as steroids and recombinant antigens, through antigen-antibody reactions. In the field of Life Sciences, this antibody is an essential tool for researchers conducting experiments involving polymerase chain reactions, acetylcholine signaling, and the study of autoantibodies. With its versatility and reliability, the p21 antibody is an invaluable asset for scientists seeking to advance their understanding of cellular processes and develop innovative medical solutions.</p>

<p>VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ</p>

<p>The KLH antibody is a highly specialized product in the field of Life Sciences. It is designed to detect and measure plasma nicotine levels, as well as study epithelial-mesenchymal transformation. This antibody is reactive to a specific test substance and can be used for various applications in research and diagnostics.</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>Factor P antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>The CPN60 antibody is a powerful tool used in the field of Life Sciences. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody specifically targets the CPN60 protein, which is involved in various cellular processes.</p>

<p>F7 antibody was raised in rabbit using the C terminal of F7 as the immunogen</p>

<p>Rabbit polyclonal GPR115 antibody</p>

<p>SLC9A3 antibody was raised in rabbit using the middle region of SLC9A3 as the immunogen</p>

<p>The FAS antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitory factor, specifically targeting the FAS protein. This acidic antibody has the ability to bind to collagen, insulin, and fibronectin, among other molecules. By binding to the FAS receptor, this antibody can induce fas-mediated apoptosis, a process that leads to targeted cell death. Additionally, it has shown cytotoxic effects against various cell types.</p>

<p>Rabbit polyclonal DDX39B antibody (biotin)</p>

<p>EPO antibody was raised in Mouse using a purified recombinant fragment of human EPO expressed in E. coli as the immunogen.</p>

<p>URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR</p>

<p>Rat monoclonal ICOS antibody (biotin)</p>

<p>Mouse monoclonal PRMT2 antibody</p>

<p>Purified native Porcine Bilirubin protein</p>

<p>ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG</p>

<p>The RBP4 monoclonal antibody is a powerful tool in the field of Life Sciences. It is a DNA aptamer that specifically targets and binds to TGF-β1, an activated growth factor involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in the detection and quantification of TGF-β1 in various biological samples.</p>

<p>ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK</p>