Produits biochimiques et réactifs

<p>NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYT</p>

<p>The Gata4 antibody is a monoclonal antibody that specifically targets the Gata4 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and shown to be cytotoxic against cells expressing high levels of Gata4, making it a valuable tool for research and diagnostic applications. Additionally, the Gata4 antibody has been used in assays to study the interaction between Gata4 and other proteins, such as urokinase plasminogen activator. It has also been utilized in studies involving adipose tissue and its role in metabolism. This monoclonal antibody is highly specific and exhibits minimal cross-reactivity with other target molecules. With its exceptional binding affinity and selectivity, the Gata4 antibody is an essential tool for researchers studying various cellular processes and developing potential therapeutic inhibitors.</p>

<p>Rabbit polyclonal IGF1R antibody (Tyr1346)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF25 antibody, catalog no. 70R-5562</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0427 antibody, catalog no. 70R-4855</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SASP antibody, catalog no. 70R-3449</p>

<p>Rabbit polyclonal VPS45 antibody</p>

<p>STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS</p>

<p>The Nav1.7 antibody is a monoclonal antibody that targets the Nav1.7 channel, a key player in pain signaling. This antibody has been extensively studied for its potential therapeutic applications in pain management. It works by blocking the activity of the Nav1.7 channel, which reduces the transmission of pain signals to the brain.</p>

<p>Rabbit polyclonal Collagen VI alpha 1 antibody</p>

<p>Rabbit polyclonal POLR2C antibody</p>

<p>The Havcr1 protein is a versatile biomolecule that plays a crucial role in various biological processes. It acts as both an annexin and an androgen, making it essential in Life Sciences research. The protein has been found to interact with chemokines, leading to neutralizing effects on their activity. Additionally, it has been shown to bind to interferons, which are vital for the immune response.</p>

<p>Mouse monoclonal IL1b antibody (PE)</p>

<p>DHDH antibody was raised in Rabbit using Human DHDH as the immunogen</p>

<p>Rabbit polyclonal SKY antibody (Tyr749/681)</p>

<p>The Fibronectin 1 antibody is a monoclonal antibody used in Life Sciences for various applications. It is commonly used as a diagnostic reagent to detect the presence of fibronectin 1, a biomolecule involved in cell adhesion and migration. This antibody specifically binds to fibronectin 1 with high affinity and specificity, making it an ideal tool for research and diagnostic purposes.</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>H2AFX antibody was raised using the N terminal of H2AFX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY</p>

<p>Purified Polyclonal Topoisomerase 2 alpha antibody</p>

<p>The 53BP1 antibody is a highly specific monoclonal antibody that targets the 53BP1 protein, a key player in the DNA damage response pathway. This antibody is widely used in life sciences research to study various cellular processes, including DNA repair and cell cycle regulation.</p>

<p>LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL</p>

<p>The LTA4H antibody is a highly effective test substance used in various applications such as electrophoresis, erythropoietin analysis, and phalloidin staining. This antibody specifically targets LTA4H, an enzyme involved in the synthesis of leukotriene B4 (LTB4), which plays a crucial role in inflammation and immune response. The LTA4H antibody is widely used in the field of Life Sciences for research purposes, including the study of actin filaments, growth factors, chemokines, and monoclonal antibodies. It is also utilized as a neutralizing agent or medicament for therapeutic applications. With its high specificity and reliability, the LTA4H antibody is an essential tool for scientists and researchers in their pursuit of understanding complex biological processes.</p>

<p>Rabbit polyclonal TrkB antibody (Tyr706+Tyr707)</p>

<p>HSP60 antibody was raised in mouse using recombinant human Hsp60 (1-573aa) purified from E. coli as the immunogen.</p>

<p>Region of GRO protein corresponding to amino acids APVANELRCQ CLQTVAGIHF KNIQSLKVMP PGPHCTQTEV IATLKNGREA CLDPEAPMVQ KIVQKMLKGV PK.</p>

<p>FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF</p>

<p>Rabbit polyclonal TAS2R13 antibody</p>

<p>Sheep polyclonal Norpropoxyphene antibody</p>

<p>Rabbit polyclonal PRPH2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its effectiveness in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP3 antibody, catalog no. 70R-2120</p>

<p>ZNF609 antibody was raised in rabbit using the N terminal of ZNF609 as the immunogen</p>

<p>Hsp90 antibody was raised in mouse using recombinant human Hsp90 (1-732aa) purified from E. coli as the immunogen.</p>

<p>FGF5 protein is a growth factor that plays a crucial role in regulating hair growth. It belongs to the family of fibroblast growth factors and is involved in various biological processes, including cell proliferation, differentiation, and tissue repair. FGF5 protein has been extensively studied for its potential therapeutic applications in the field of hair loss treatment.</p>

<p>MAP4K4 antibody was raised in Mouse using a purified recombinant fragment of MAP4K4(aa400-500) expressed in E. coli as the immunogen.</p>

<p>The PCNA antibody is a highly specialized product in the field of Life Sciences. It is an autoantibody that specifically targets the proliferating cell nuclear antigen (PCNA), a protein that plays a crucial role in DNA replication and repair. This monoclonal antibody has been extensively studied and proven to be effective in neutralizing PCNA activity.</p>

<p>Affinity purified Rabbit polyclonal Chromogranin C antibody</p>

<p>Purified recombinant SFTPD protein (His tag)</p>

<p>Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED</p>

<p>MTNR1B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>HBD antibody was raised in Rabbit using Human HBD as the immunogen</p>

<p>The CD61 antibody is a monoclonal antibody that specifically targets the CD61 protein. This protein plays a crucial role in various cellular processes, including cell adhesion and platelet aggregation. The CD61 antibody has been extensively studied in the field of life sciences, particularly in research related to epidermal growth factor and insulin antibodies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC144B antibody, catalog no. 70R-3405</p>

<p>Purified Polyclonal FR gamma antibody</p>

<p>TRAF3IP2 antibody was raised in rabbit using the N terminal of TRAF3IP2 as the immunogen</p>

<p>DDB2 antibody was raised in rabbit using the C terminal of DDB2 as the immunogen</p>

<p>Recombinant Human PTRHD1 protein</p>

<p>Mouse monoclonal PPARA antibody</p>

<p>Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of ESR1(aa301-595) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MORF4L1 antibody, catalog no. 70R-7949</p>

<p>MDC antibody was raised in rabbit using highly pure recombinant hMDC as the immunogen.</p>

<p>The PDGFD antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor PDGFD. This antibody contains a cycloalkyl group that enhances its stability and binding affinity. It has been shown to effectively inhibit the activity of PDGFD in various biological assays, including low-density electrode-based assays and transferrin uptake assays.</p>

<p>Purified recombinant Human UBE2J2 Protein (His tag)</p>

<p>Rabbit polyclonal PDIA3 antibody (HRP)</p>

<p>TAL2 antibody was raised in rabbit using the N terminal of TAL2 as the immunogen</p>

<p>The BCL2 antibody is a monoclonal antibody that specifically targets the BCL2 protein. This protein is involved in regulating cell death and has been implicated in various diseases, including cancer and neurodegenerative disorders. The BCL2 antibody is reactive and neutralizing, meaning it can bind to the BCL2 protein and prevent its activity.</p>

<p>The HRH1 antibody is a monoclonal antibody that targets the histamine H1 receptor. It plays a crucial role in allergic reactions and inflammation. This antibody specifically recognizes and binds to the histamine H1 receptor, preventing it from interacting with histamine and inhibiting its signaling pathway. The HRH1 antibody has been extensively studied in various life sciences research fields, including acetylation and methylation studies, collagen research, and phosphorylation site analysis. It has also shown potential antinociceptive properties, making it a promising candidate for pain management. Additionally, this antibody can be utilized in the development of novel medicines targeting the histamine H1 receptor. With its high specificity and affinity, the HRH1 antibody is a valuable tool for researchers in need of reliable antibodies for their experiments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Shkbp1 antibody, catalog no. 70R-8074</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Rabbit polyclonal OR7E5P antibody</p>

<p>Purified Rabbit polyclonal FADD antibody (Ser191)</p>

<p>LDHAL6B antibody was raised using the middle region of LDHAL6B corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA</p>

<p>Mouse monoclonal CST3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HK2 antibody, catalog no. 70R-3448</p>

<p>CLACP antibody was raised in rabbit using residues 171-183 [NHGFLSADQQLIK] of the NC2-1 region of human and mouse CLAC-P as the immunogen.</p>

<p>OSBPL8 antibody was raised using the middle region of OSBPL8 corresponding to a region with amino acids YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR</p>

<p>Affinity purified Rabbit polyclonal TRIM37 antibody</p>

<p>The EGFR antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It has been shown to inhibit the activity of EGFR by preventing its interaction with ligands, such as epidermal growth factor (EGF). This inhibition leads to a decrease in downstream signaling pathways involved in cell proliferation and survival. The EGFR antibody has been extensively studied in the field of Life Sciences and has been found to have neutralizing effects on the activity of EGFR. It has also been shown to block the formation of dimers between EGFR and other receptors, such as HER2. Additionally, this antibody can bind to autoantibodies present in human serum, further inhibiting EGFR signaling. The EGFR antibody is commonly used in research laboratories for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry. Its high specificity and affinity make it an ideal tool for studying the role of EGFR in cellular processes and</p>

<p>Mouse monoclonal TFIIH antibody (N-terminus)</p>

<p>The NGAL antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to NGAL (Neutrophil Gelatinase-Associated Lipocalin), a protein involved in various biological processes. This antibody has been extensively studied and proven effective in immunohistochemistry, where it is used to detect the presence and localization of NGAL in tissues.</p>

<p>Affinity purified Rabbit polyclonal ENTPD5 antibody</p>

<p>AQP1 antibody was raised in Rabbit using Human AQP1 as the immunogen</p>

<p>STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HEXIM2 antibody, catalog no. 70R-4973</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NP antibody, catalog no. 70R-2286</p>

<p>Purified recombinant AP3S1 protein</p>

<p>Affinity purified Rabbit polyclonal ASB9 antibody</p>

<p>COG7 antibody was raised in Rabbit using Human COG7 as the immunogen</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 190-196 of cTnI as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTGER3 antibody, catalog no. 70R-6938</p>

<p>Metoclopramide Hydrochloride (USP grade powder) chemical reference substance</p>

<p>PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRISPLD2 antibody, catalog no. 70R-7445</p>

<p>The RRM1 antibody is a monoclonal antibody that specifically targets the alpha-msh growth factor receptor. This antibody has high affinity and specificity for the receptor, allowing it to effectively bind and block its activity. It is commonly used in life sciences research to study the function and signaling pathways of the alpha-msh growth factor.</p>

<p>PYGM antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARL13B antibody, catalog no. 70R-4152</p>

<p>MLH1 antibody was raised in Mouse using a purified recombinant fragment of MLH1 (aa381-483) expressed in E. coli as the immunogen.</p>

<p>ATCAY antibody was raised in rabbit using the C terminal of ATCAY as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRH antibody, catalog no. 70R-7142</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>Rabbit polyclonal CPXM2 antibody</p>

<p>DDR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KLH antibody is a peptide conjugate that is used to detect and neutralize TGF-β1, a cytokine involved in cell growth and differentiation. This antibody specifically targets and binds to TGF-β1, preventing its interaction with cell receptors and inhibiting its biological activity. In addition to its neutralizing properties, KLH antibody has been shown to have cytotoxic effects on cells expressing TGF-β1 receptors. It can also be used in various life science applications, such as the detection of collagen, interleukin-6, parathyroid hormone-related peptide, hepcidin, and other biomolecules. The high specificity of this monoclonal antibody ensures reliable results in antigen-antibody reactions. Whether you're conducting research or developing diagnostic assays, KLH antibody is an essential tool for your laboratory.</p>

<p>GDNF antibody was raised in rabbit using highly pure recombinant human GDNF as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal RIC8A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound that belongs to the class of antituberculosis drugs known as rifamycins. This powerful drug is specifically designed for the treatment of tuberculosis infection. It exhibits bactericidal activity by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0515 antibody, catalog no. 70R-3603</p>

<p>The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.</p>

<p>The HAIR antibody is a highly specialized protein that targets androgen receptors. It is a polyclonal antibody, meaning it is derived from multiple sources and can recognize various epitopes on the target protein. This antibody has cytotoxic properties, meaning it can induce cell death in cells expressing the androgen receptor.</p>

<p>Rabbit polyclonal CELF1 antibody</p>