Produits biochimiques et réactifs

<p>Purified Polyclonal HEXB antibody</p>

<p>G6PD antibody was raised in mouse using recombinant human G6PD (35-506aa) purified from E. coli as the immunogen.</p>

<p>OVA conjugated Sulfadimethoxine Hapten</p>

<p>The Doublecortin antibody is a highly specialized product that belongs to the category of Polyclonal Antibodies. It is designed to target and bind to the doublecortin protein, which plays a crucial role in neurogenesis and neuronal migration. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and immunofluorescence.</p>

<p>The ANXA3 antibody is a highly specific monoclonal antibody that targets the Annexin A3 protein. This protein is involved in various cellular processes, including transferrin binding, amyloid plaque formation, and regulation of alpha-fetoprotein levels. The ANXA3 antibody can be used in research and diagnostic applications to detect the presence and localization of Annexin A3 in different tissues and biological samples.</p>

<p>MARS antibody was raised in mouse using recombinant Methionine-Trna Synthetase</p>

<p>Purified Rabbit polyclonal PR antibody (Ser294)</p>

<p>The Growth hormone receptor protein is a crucial component in Life Sciences. It acts as an inhibitory factor against glial fibrillary acidic emission and interleukin-6 factor-α. This protein plays a significant role in regulating the growth hormone receptor, which is essential for various biological processes. The acidic nature of the protein allows it to bind effectively to cellulose, activating its neutralizing and reactive properties. Conjugated Proteins, such as interferon, are also influenced by this protein, making it a vital player in the field of Proteins and Antigens.</p>

<p>The MN1 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets fibrinogen, an activated protein involved in blood clotting. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The MN1 antibody has been shown to effectively bind to virus surface antigens and neutralize their activity, making it a valuable tool for antiviral research. Additionally, this antibody has been used in mass spectrometric methods to identify and quantify chemokines and interferons in human serum samples. With its high specificity and affinity, the MN1 antibody is an essential component of any researcher's toolkit in the field of Life Sciences.</p>

<p>Mouse monoclonal PECR antibody</p>

<p>The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.</p>

<p>Rabbit polyclonal MED13L antibody</p>

<p>SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKT</p>

<p>Monoclonal Rat anti-Mouse IgD antibody (FITC)</p>

<p>Purified Polyclonal Monoamine Oxidase A antibody</p>

<p>Recombinant Human GBA3 protein</p>

<p>Mouse monoclonal NK1.1 antibody (FITC)</p>

<p>Please enquire for more information about 4-Methoxy(toluene-d7) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAF15 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYS</p>

<p>PAPK antibody was raised in rabbit using residues 399-418 (SPWSELEFQFPDDKDPVWEF) of the mouse PAPK protein as the immunogen.</p>

<p>TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL</p>

<p>Mouse monoclonal NUPR1 antibody</p>

<p>Mouse monoclonal H6PD antibody</p>

<p>Purified recombinant GAGE2D protein (His tag)</p>

<p>Purified Polyclonal CstF 64 antibody</p>

<p>ZNF451 antibody was raised in rabbit using the C terminal of ZNF451 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been proven through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Furthermore, it undergoes metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The UBE1 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of polyclonal antibodies and is specifically designed for inhibiting the activity of ubiquitin, a protein involved in various cellular processes. This antibody is highly effective in blocking the function of ubiquitin, making it an essential tool for researchers studying the role of ubiquitin in protein degradation, DNA repair, and other important cellular pathways. With its high specificity and potency, the UBE1 antibody is a valuable asset for any laboratory working in the field of molecular biology.</p>

<p>Rabbit polyclonal GBP3 antibody</p>

<p>MPRIP antibody was raised in Rabbit using Human MPRIP as the immunogen</p>

<p>MRGPRF antibody was raised in rabbit using the C terminal of MRGPRF as the immunogen</p>

<p>The MMP3 antibody is a highly specialized antibody that targets matrix metalloproteinase 3 (MMP3). This antibody is extensively used in the field of Life Sciences for various applications. It is a glycosylated protein that belongs to the family of matrix metalloproteinases, which play a crucial role in tissue remodeling and degradation. The MMP3 antibody specifically binds to MMP3 and inhibits its activity, making it an essential tool for studying the function of this enzyme.</p>

<p>The P130 antibody is a monoclonal antibody that is produced by a hybridoma cell line. It belongs to the class of chimeric proteins and is widely used in Life Sciences research. This antibody specifically targets and binds to the amino-terminal region of natriuretic peptides, which are important biomarkers for heart-related diseases. The P130 antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. It has high specificity and sensitivity, making it an ideal tool for studying the expression and function of natriuretic peptides in different tissues and cell types. The P130 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs. Trust in the reliability and quality of the P130 antibody for your research needs in the field of Life Sciences.</p>

<p>DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS</p>

<p>Rabbit polyclonal MYL3 antibody</p>

<p>GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GPC3 antibody was raised in Rabbit using Human GPC3 as the immunogen</p>

<p>Rabbit polyclonal GOLM1 antibody (biotin)</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL</p>

<p>GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH</p>

<p>BCL9 antibody was raised in mouse using recombinant Human B-Cell Cll/Lymphoma 9 (Bcl9)</p>

<p>Mouse monoclonal GBA3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting strong bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>IL22 antibody was raised in rabbit using highly pure recombinant murine IL-22 as the immunogen.</p>

<p>GEM antibody was raised using the N terminal of GEM corresponding to a region with amino acids KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQ</p>

<p>Purified recombinant IDO1 protein (His tag)</p>

<p>UBA1 antibody was raised using the N terminal of UBA1 corresponding to a region with amino acids MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAV</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>GPR18 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The NAC1 antibody is a monoclonal antibody that targets interleukin-6 (IL-6), a growth factor involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting IL-6 signaling. It can also be used as an anti-HER2 antibody, targeting the HER2 receptor on cancer cells. The NAC1 antibody has been shown to inhibit endothelial growth and may have potential therapeutic applications in cancer treatment. Additionally, it has been found to modulate the viscosity of antibodies, enhancing their efficacy. This antibody holds great promise for targeted therapy and further research in the field of immunology.</p>

<p>HEXIM1 antibody was raised in Rabbit using Human HEXIM1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR0B1 antibody, catalog no. 70R-1004</p>

<p>Purified recombinant AMMECR1L protein (His tag)</p>

<p>F2R antibody was raised in rabbit using the C terminal of F2R as the immunogen</p>

<p>BTBD1 antibody was raised in Rabbit using Human BTBD1 as the immunogen</p>

<p>GTPBP4 antibody was raised using the C terminal of GTPBP4 corresponding to a region with amino acids MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR</p>

<p>EIF2C4 antibody was raised using the middle region of EIF2C4 corresponding to a region with amino acids DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR</p>

<p>Purified recombinant NDUFV3 protein (His tag)</p>

<p>TFEB antibody is a monoclonal antibody that specifically targets and binds to TFEB, a protein involved in various cellular processes. TFEB plays a crucial role in the regulation of autophagy, lysosomal biogenesis, lipid metabolism, and cellular homeostasis. This antibody can be used in Life Sciences research to study the function and localization of TFEB within cells. It has been shown to inhibit the phosphatase activity of TFEB and modulate its interaction with other proteins such as growth hormone receptor, lipoprotein lipase, and triglyceride lipase. Additionally, this antibody has been used in studies related to adipose tissue development, growth factor signaling pathways, and endothelial growth. Its high specificity and affinity make it a valuable tool for researchers studying TFEB-related processes in various biological contexts.</p>

<p>The CD11d antibody is a potent phosphatase that belongs to the family of antibodies. It specifically targets alpha-fetoprotein, a glycoprotein that is involved in various biological processes. This monoclonal antibody has been shown to inhibit the activity of dopamine, collagen, and growth factors by binding to their respective receptors. Additionally, the CD11d antibody can be used as an electrode for detecting specific proteins or molecules in various life science applications. It has also demonstrated inhibitory effects on the circumsporozoite protein, which is essential for the survival of certain parasites. With its versatile properties and wide range of applications, the CD11d antibody is a valuable tool in research and diagnostics.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DMPK antibody, catalog no. 70R-3702</p>

<p>MOCOS antibody was raised in Rabbit using Human MOCOS as the immunogen</p>

<p>Rabbit polyclonal VASP antibody (Ser238)</p>

<p>Rabbit Polyclonal eIF4B antibody (Ser422)</p>

<p>PADI2 antibody was raised using the middle region of PADI2 corresponding to a region with amino acids RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV</p>

<p>Purified Polyclonal Caspase 7 p11 antibody</p>

<p>Rabbit polyclonal SNX15 antibody</p>

<p>LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK</p>

<p>Purified recombinant Human ADPRH protein (His tag)</p>

<p>Rabbit polyclonal RPS12 antibody</p>

<p>GPSM1 antibody was raised in Rabbit using Human GPSM1 as the immunogen</p>

<p>Mouse monoclonal PAICS antibody</p>

<p>Rabbit Polyclonal CHSS2 antibody</p>

<p>The eNOS antibody is a monoclonal antibody used in Life Sciences research. It specifically targets endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody is widely used to study the role of eNOS in various physiological processes, including lipoprotein lipase activity, antiviral responses, and growth factor signaling pathways. The eNOS antibody can be immobilized on electrodes or used in colloidal form for detection and quantification of eNOS in samples such as human serum. Additionally, this antibody has been shown to have neuroprotective effects and can modulate interferon signaling pathways. Its high specificity and ability to recognize different forms of eNOS due to glycosylation make it a valuable tool for researchers studying various cellular processes.</p>

<p>Purified Polyclonal NKX31 antibody</p>

<p>The XIAP antibody is a hormone peptide that belongs to the class of antibodies. It specifically targets serum albumin, particularly human serum albumin, and acts as a neutralizing agent. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on various growth factors, chemokines, and epinephrine-like molecules. The XIAP antibody is available in both polyclonal and monoclonal forms, making it suitable for different research applications. Its high specificity and affinity make it an essential tool for studying protein-protein interactions and signaling pathways. With its ability to block the activity of specific molecules, the XIAP antibody offers great potential for therapeutic interventions in various diseases.</p>

<p>Human IgE antibody was raised in mouse using immunoglobulin E from myelomatous human serum.</p>

<p>FAP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal STX7 antibody</p>

<p>LOC728331 antibody was raised using the N terminal of LOC728331 corresponding to a region with amino acids AALGRTRAPNGATPRGEDGLSPTPTPGTDASGKGRGRPGKRGAPGGRADP</p>

<p>Rabbit polyclonal CDC25A antibody</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>GaTx2 is a costimulatory molecule that binds to the B7-1 and B7-2 receptors on the surface of antigen-presenting cells. GaTx2 has been shown to regulate transcriptional regulation, cellular growth, and physiological function in heart tissue. It is also involved in the development of cancer and autoimmune diseases. GaTx2 has biological properties that are similar to those of T lymphocyte growth factor (TGF) and basic fibroblast growth factor (bFGF). GaTx2 is also a whole-cell voltage clamp that can be used in tissue culture.</p>

<p>Purified recombinant Human GP9 protein (His tag)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Recombinant Human MOSPD1 protein</p>

<p>DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL</p>

<p>The CaMK4 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets and binds to CaMK4, which stands for calcium/calmodulin-dependent protein kinase 4.</p>

<p>FXR2 antibody was raised using the middle region of FXR2 corresponding to a region with amino acids RGRRTGGPAYGPSSDVSTASETESEKREEPNRAGPGDRDPPTRGEESRRR</p>

<p>KRT19 antibody was raised in Rabbit using Human KRT19 as the immunogen</p>

<p>Purified Recombinant Cadherin 5 protein (His tagged)</p>

<p>Human Albumin antibody (Alk Phos)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC19 antibody, catalog no. 70R-6343</p>

<p>TADA2L antibody was raised in rabbit using the C terminal of TADA2L as the immunogen</p>

<p>Mouse monoclonal IFN gamma antibody (FITC)</p>

<p>SPINK1 antibody was raised using the N terminal of SPINK1 corresponding to a region with amino acids KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG</p>

<p>Mouse monoclonal IgM antibody (biotin)</p>

<p>Rabbit polyclonal DOCK1 antibody</p>