Produits biochimiques et réactifs

<p>Mouse monoclonal ANAPC2 antibody</p>

<p>UBXD2 antibody was raised in rabbit using the middle region of UBXD2 as the immunogen</p>

<p>Influenza A antibody (H3N2) (FITC) was raised in goat using Influenza A, strain Texas 1/77 (H3N2) as the immunogen.</p>

<p>Rabbit polyclonal NFKP p100/p52 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTA1 antibody, catalog no. 70R-10211</p>

<p>Isorauhimbin is an indole alkaloid, which is derived from the plant family Apocynaceae. It is primarily sourced from the bark of Rauwolfia plants, where it exists as one of the stereoisomers of yohimbine. The mode of action of Isorauhimbin involves its interaction with adrenergic receptors, specifically acting as an antagonist at the alpha-2 adrenergic receptors. This interaction results in increased release of norepinephrine and enhanced sympathetic nervous system activity.</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL27 antibody, catalog no. 70R-10164</p>

<p>Rabbit polyclonal VEGFR1 antibody (Tyr1048)</p>

<p>GDF5 protein containing region of amino acids corresponding to: APSATRQGKR PSKNLKARCS RKALHVNFKD MGWDDWIIAP LEYEAFHCEG LCEFPLRSHL EPTNHAVIQT LMNSMDPEST PPTCCVPTRL SPISILFIDS ANNVVYKQYE DMVVESCGCR.</p>

<p>C2orf60 antibody was raised in rabbit using the middle region of C2ORF60 as the immunogen</p>

<p>The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically detect and bind to phosphotyrosine residues, which are important markers of activated signaling pathways. This antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal CXCL1 antibody (biotin)</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>Rabbit polyclonal SDP3 antibody (biotin)</p>

<p>KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF</p>

<p>Mouse monoclonal THRA antibody (a2-Isotype)</p>

<p>IL2Ra antibody was raised in mouse using recombinant human soluble IL-2 Receptor alpha as the immunogen.</p>

<p>The Cytochrome P450 2D6 antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism, particularly in the metabolism of drugs that are commonly used in neurological and psychiatric disorders.</p>

<p>AKR1B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI</p>

<p>VISA antibody was raised using the N terminal of VISA corresponding to a region with amino acids ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH</p>

<p>Purified recombinant CD27 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAF7 antibody, catalog no. 70R-5931</p>

<p>Rabbit polyclonal CEBP epsilon antibody (Thr74)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR1I3 antibody, catalog no. 70R-1002</p>

<p>The NK3R antibody is a monoclonal antibody that is used in various immunoassays and research applications in the field of Life Sciences. It specifically targets the fibronectin growth factor receptor, which is known to be involved in cellular processes such as cell adhesion, migration, and proliferation. The NK3R antibody has been shown to neutralize the activity of fibronectin, preventing its binding to the receptor and inhibiting downstream signaling pathways. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry to detect and quantify the presence of fibronectin in samples. Additionally, the NK3R antibody has been used in electrochemical biosensing techniques to develop sensitive and specific assays for the detection of fibronectin biomarkers. Its high affinity and specificity make it a valuable tool for researchers studying fibronectin-related processes and diseases.</p>

<p>Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK</p>

<p>DUSP13 antibody was raised in Rabbit using Human DUSP13 as the immunogen</p>

<p>FGF9 antibody was raised in rabbit using highly pure recombinant murine FGF-9 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERGIC3 antibody, catalog no. 70R-6447</p>

<p>Rabbit Polyclonal DHRS2 antibody</p>

<p>KARS antibody was raised in Mouse using a purified recombinant fragment of KARS(aa90-174) expressed in E. coli as the immunogen.</p>

<p>Rabbit Polyclonal MGST2 antibody</p>

<p>Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA</p>

<p>TIMP2 protein is a glycopeptide that plays a crucial role in various biological processes in the field of Life Sciences. It acts as a regulator of matrix metalloproteinases (MMPs) and inhibits their activity, thus preventing excessive tissue degradation. TIMP2 protein has been shown to neutralize the effects of interleukin-6 (IL-6) and granulocyte-macrophage colony-stimulating factor (GM-CSF), which are pro-inflammatory cytokines involved in immune responses.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>NMNAT1 protein is a key component in various biological processes, particularly in mesenchymal stem cells. It can be targeted using a specific monoclonal antibody to study its functions and interactions. NMNAT1 has been implicated in regulating hemolysis, protein kinase activity, and the expression of other proteins and antigens. Additionally, it plays a role in modulating the levels of TNF-α and chemokines, which are important factors in immune responses. Autoantibodies against NMNAT1 have been observed in certain autoimmune disorders, and their effects can be studied using inhibitors such as adalimumab. This protein is also involved in endothelial growth and dopamine signaling pathways. Furthermore, it has been shown to interact with necrosis factor-related apoptosis-inducing ligand (TRAIL), which may have implications for cancer research. Overall, NMNAT1 protein is a fascinating molecule with diverse functions that warrant further exploration in the field of life sciences.</p>

<p>The LDB1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets the LDB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in applications such as immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPRR3 antibody, catalog no. 70R-3927</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UNC50 antibody, catalog no. 70R-6571</p>

<p>The MELK antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as Maternal Embryonic Leucine Zipper Kinase (MELK). This glycoprotein plays a crucial role in various cellular processes, including cell division, proliferation, and differentiation.</p>

<p>Rabbit polyclonal SUPT16H antibody</p>

<p>Papaverine is a plant alkaloid that has been shown to be effective as an analgesic and anti-inflammatory agent. It is used in the treatment of chronic pain and inflammation, but its mechanism of action is not well understood. Papaverine has been shown to inhibit the production of growth factors, such as platelet-derived growth factor (PDGF), by cells. Papaverine also has effects on the immune system and may act through toll-like receptor 4 (TLR4) to inhibit tumor cell proliferation. The effective dose for papaverine ranges from 1 mg to 10 mg per day, depending on the condition being treated. This drug can be administered orally or intravenously as a pharmaceutical preparation.</p>

<p>CTSF antibody was raised in Rabbit using Human CTSF as the immunogen</p>

<p>Rabbit polyclonal IRS1 antibody (Ser323)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT14 antibody, catalog no. 70R-7437</p>

<p>SLC22A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW</p>

<p>IL8RB antibody was raised using the N terminal of IL8RB corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF</p>

<p>The EP4 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that targets and binds to the EP4 receptor, which plays a crucial role in various biological processes. This monoclonal antibody has been extensively studied and proven to be effective in blocking the activity of the EP4 receptor.</p>

<p>The USP15 antibody is a highly specialized monoclonal antibody used in various life sciences applications. It is derived from a benzazepine compound and has been extensively studied for its cytotoxic properties. This antibody specifically targets and binds to USP15, a protein involved in the regulation of various cellular processes.</p>

<p>Akt, also known as Protein Kinase B (PKB), is an essential cellular protein that governs vital processes such as cell growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones like insulin. Upon activation, Akt translocates to the cell membrane, where it undergoes full activation via phosphorylation by kinases like PDK1. This activation allows Akt to prevent apoptosis, promote cell growth via pathways like mTOR, and boost glucose metabolism, crucial for insulin responsiveness. Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA</p>

<p>Morphine-3 antibody was raised in mouse using morphine-3 as the immunogen.</p>

<p>Epithelium specific antigen antibody was raised in Mouse using HT-29 colon carcinoma cell line as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB5 antibody, catalog no. 70R-6842</p>

<p>The Kv1.5 antibody is a growth factor that plays a crucial role in multidrug resistance and immunoassays. It is a polyclonal antibody that specifically targets the Kv1.5 protein kinase, which is involved in various cellular processes. This antibody can be used in research and diagnostic applications to detect and quantify the expression of Kv1.5 in different samples.</p>

<p>IGSF8 antibody was raised in Rabbit using Human IGSF8 as the immunogen</p>

<p>The G3BP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the G3BP1 protein, which plays a crucial role in various cellular processes such as collagen synthesis, antigen presentation, and growth factor signaling. This antibody has been extensively tested and validated for its high affinity and specificity towards G3BP1.</p>

<p>Purified Rabbit polyclonal TIFIA antibody (Ser649)</p>

<p>CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.</p>

<p>Sheep polyclonal Norescitalopram antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GCS1 antibody, catalog no. 70R-6629</p>

<p>Cytokeratin 8 antibody was raised using the middle region of KRT8 corresponding to a region with amino acids QSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAE</p>

<p>STOM antibody is a neutralizing antibody that belongs to the family of kinase inhibitors. It is widely used in the field of Life Sciences for various applications. This polyclonal antibody specifically targets STOM (Stomatin) molecules, which are involved in the regulation of ion channels and membrane transporters. STOM antibody has been shown to be effective in neutralizing the activity of STOM, thereby inhibiting its function. This antibody can be used in research studies involving mesenchymal stem cells, as well as in experiments investigating the role of growth factors such as epidermal growth factor. The high specificity and affinity of this antibody make it an ideal tool for studying the functions and signaling pathways associated with STOM. It is available as both monoclonal and polyclonal antibodies, ensuring flexibility in experimental design. The formulation includes excipients to ensure stability and long shelf life.</p>

<p>ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen</p>

<p>Chlamydia trachomatis antibody (HRP) was raised in goat using L2 and other serovar groups as the immunogen.</p>

<p>Rabbit polyclonal TSHZ1 antibody</p>

<p>NDUFB1 antibody was raised in Rabbit using Human NDUFB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT4 antibody, catalog no. 70R-7245</p>

<p>Rabbit polyclonal TMF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UPF3B antibody, catalog no. 70R-4711</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1A1L antibody, catalog no. 70R-9204</p>

<p>PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA</p>

<p>The NSE antibody is a monoclonal antibody that is used in various Life Sciences applications. It specifically targets tyrosine residues and can be used in immunohistochemistry, immunoblotting, and other protein detection assays. The NSE antibody has been shown to react with coagulation factors, TNF-α, and various monoclonal antibodies. It is also effective in detecting antiphospholipid antibodies and has been used in research related to protein kinases and collagen. Additionally, the NSE antibody can be used for neutralizing assays. With its high specificity and versatility, this antibody is a valuable tool for researchers in the Life Sciences field.</p>

<p>Purified Human IgG Fab'2 for use as a control or blocking reagent</p>

<p>Region of Follistatin protein corresponding to amino acids GNCWLRQAKN GRCQVLYKTE LSKEECCSTG RLSTSWTEED VNDNTLFKWM IFNGGAPNCI PCKETCENVD CGPGKKCRMN KKNKPRCVCA PDCSNITWKG PVCGLDGKTY RNECALLKAR CKEQPELEVQ YQGRCKKTCR DVFCPGSSTC VVDQTNNAYC VTCNRICPEP ASSEQYLCGN DGVTYSSACH LRKATCLLGR SIGLAYEGKC IKAKSCEDIQ CTGGKKCLWD FKVGRGRCSL CDELCPDSKS DEPVCASDNA TYASECAMKE AACSSGVLLE VKHSGSCN.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIB1 antibody, catalog no. 70R-9178</p>

<p>Auh antibody was raised in rabbit using the N terminal of Auh as the immunogen</p>

<p>2-Butoxy-9-(2,6-difluorobenzyl)-N-(2-morpholin-4-ylethyl)-9H-purin-6-amine is a peptide ligand that is used as a research tool in the fields of cell biology, pharmacology, and life sciences. This compound has been shown to inhibit ion channels such as voltage gated sodium channels and potassium channels. 2BODAM also blocks voltage gated calcium channels and inhibits receptor binding by interacting with antibodies on the surface of cells.</p>

<p>InSolution AG 1478 is a tyrosine kinase inhibitor that binds to the ATP-binding site of tyrosine kinases. In vitro studies have shown that it inhibits the activation of epidermal growth factor receptor and nerve growth factor receptors, and blocks epidermal growth factor (EGF) and nerve growth factor (NGF) induced phosphorylation in mouse epidermal cells. In vivo animal studies show that this drug has an effect on axonal growth and promotes nerve regeneration. In vitro studies also show that it inhibits DNA binding activity in response to EGF or NGF.</p>

<p>Inducer of endoderm formation in embryonic stem cells</p>

<p>AC 264613 is a serine protease inhibitor that inhibits the activity of cathepsin B, which is an enzyme that degrades extracellular matrix proteins and plays a role in inflammation. AC 264613 has been shown to be effective against influenza virus, HIV-1, and herpes simplex virus type 1. This drug also blocks the activation of colony-stimulating factor by inhibiting the production of neutrophils. It has been shown to inhibit the activation of toll-like receptor 4 (TLR4) by preventing hyperpolarization of cells membranes. AC 264613 is a stereoselective compound that can be used for assays as it binds to polyvinylpyrrolidone (PVP).</p>

<p>Fluorizoline is an active analog of ubiquitin, a small protein that plays a role in the process of protein degradation. It binds to the ubiquitin-proteasome pathway and inhibits the growth of cancer cells by inhibiting protein synthesis. Fluorizoline has been shown to induce apoptosis in some cancer cells through the involvement of intracellular Ca2+ levels and pro-apoptotic proteins. This drug also has anti-inflammatory properties, which may be due to its ability to inhibit epidermal growth factor (EGF) and tumor necrosis factor alpha (TNFα).</p>

<p>14:0 Ps-d54 is a Research Tool that is used in Cell Biology and Pharmacology. It functions as an inhibitor of ion channels and Ligands. 14:0 Ps-d54 can be used to investigate the interactions between Proteins and Peptides, as well as the activation of Receptors. This product has a CAS No. 327178-93-8 and is manufactured by Life Science. The purity level of this product is High.</p>

<p>12:0 Lyso NBD PC is a fluorescent lipid probe, which is an analog of lysophosphatidylcholine. This synthetic product is derived from phospholipids modified with a NBD (7-nitro-2-1,3-benzoxadiazol-4-yl) fluorophore. Its primary manner of action involves integration into cellular membranes, where it enhances the visualization of lipid domains and membrane trafficking through fluorescence microscopy or flow cytometry.</p>

<p>Mitoebselen-2 is a peptide that is an activator of ion channels. It has been shown to inhibit the activity of protein interactions by binding to receptors and ligands. Mitoebselen-2 has been used in research as a tool for studying cell biology and pharmacology, as well as antibody production. Mitoebselen-2 has shown no adverse effects on mammals and can be used without restriction.</p>

<p>5-Chloro-N-(2-piperidin-1-ylphenyl)thiophene-2-sulfonamide is a chemical compound that falls under the category of small molecule inhibitors. This compound is synthesized through organic chemical processes and is primarily studied for its potential interactions with various biological targets. Its mode of action often involves binding to specific proteins or receptors, leading to the modulation of certain physiological pathways. It is particularly noted for its potential affinity for certain enzymes or cellular receptors, which could be relevant in research focusing on conditions such as inflammation or cancer.</p>

<p>2,2,6-Trimethyl-4-(4-nitrobenzo(1,2,5)oxadiazol-7-ylamino)-6-pentylpiperidine-1-oxyl is a research tool that belongs to the group of activator ligands. It is used as an activator for ion channels such as nicotinic acetylcholine receptors and voltage gated potassium channels. 2,2,6-Trimethyl-4-(4-nitrobenzo(1,2,5)oxadiazol-7-ylamino)-6-pentylpiperidine-1-oxyl has been shown to bind to the extracellular domain of the receptor and induce conformational changes in the protein. The binding site has also been identified as being within a region of the receptor involved in protein interactions. This compound may also be used as a reagent in pharmacology or as a research tool in</p>

<p>Vincristine is an anticancer agent that belongs to the class of chemotherapeutic agents. It has been used in the treatment of retinoblastoma, Hodgkin's disease, and other cancers. Vincristine-d3 sulfate is a radiochemical precursor of vincristine that can be used for the determination of this drug in biological matrices. The sensitivity of this compound is high and it has no matrix effect. The linear range for vincristine-d3 sulfate is between 1-10 µg/mL, which makes it suitable for use with sample volumes less than 10 mL. This compound can also be analyzed by liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS).</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its potential through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Induces expression of Oct3/4 transcription factor</p>

<p>Enhances autophagy</p>

<p>Rabbit Polyclonal EGFR antibody (Tyr869)</p>

<p>DDX27 antibody was raised in Rabbit using Human DDX27 as the immunogen</p>

<p>Rabbit polyclonal RNF181 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BNIP1 antibody, catalog no. 70R-9801</p>

<p>Rabbit polyclonal Retinoic Acid Receptor beta antibody</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>CXCL16 antibody was raised in goat using highly pure recombinant murine CXCL16 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal LALBA antibody</p>