Produits biochimiques et réactifs

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>

<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>ELISA kit for detection of P-Selectin in the research laboratory</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>ELISA kit for the detection of MCP1 in the research laboratory</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA kit for detection of Human IL6 in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>ELISA kit for detection of Cystatin C in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9794</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>

<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>ELISA Kit for detection of Oxytocin in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Purified recombinant LGALS1 protein (His tag)</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>ELISA kit for detection of EGFR in the research laboratory</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>ELISA kit for the detection of Lactoferrin in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>Arabidopsis Thaliana Plant Lysate</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>

<p>ELISA kit for the detection of PTH intact in the research laboratory</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Mouse Fibronectin ELISA Kit</p>

<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>

<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>

<p>Pig IgM ELISA Kit</p>

<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>

<p>Rabbit IgM ELISA Kit</p>

<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>Rabbit IgA ELISA Kit</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>

<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>Recombinant Mouse MASP2 protein</p>

<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cat Haptoglobin ELISA Kit</p>

<p>Dog Transferrin ELISA Kit</p>

<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>Quantify pig albumin in your samples.</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>ELISA Kit for detection of Leukotriene B4 in the research laboratory</p>

<p>ELISA Kit for detection of NGFb in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>ELISA kit for detection of Fibronectin in the research laboratory</p>

<p>ELISA kit for detection of Serotonin in the research laboratory</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>ELISA Kit for detection of IL25 in the research laboratory</p>

<p>ELISA kit for the detection of Pregnenolone  in the research laboratory</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>ELISA Kit for detection of AVP in the research laboratory</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>ELISA Kit for detection of Estradiol antibody in the research laboratory</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>Enzyme Immunoassay for the Quantitative Determination of purified M13 Bacteriophage Particles</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human sequence expressed in sf Insect Cells; purity &gt;97% by SDS-PAGE and analyzed by silver stain.</p>

<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>

<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>Purified recombinant Human DECR1 protein</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>Quantify total bovine IgA in your samples.</p>

<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Guinea Pig IgA ELISA Kit</p>

<p>Mouse Myoglobin ELISA Kit</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>Pig IgA ELISA Kit</p>

<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human sequence expressed in CHO Cells; purity &gt;95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>

<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig Plasminogen ELISA Kit</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>