Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.116 produits)
- Par Biological Target(99.075 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.700 produits)
- Métabolites secondaires(14.220 produits)
130578 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Mac2BP ELISA kit
<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>Degré de pureté :Min. 95%IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Degré de pureté :Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Degré de pureté :Min. 95%Human CX3CL1 ELISA Kit
<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>Degré de pureté :Min. 95%C1ORF131 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>Degré de pureté :Min. 95%CD152 antibody (PE)
<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>Degré de pureté :Min. 95%dsDNA IgM ELISA kit
<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>Degré de pureté :Min. 95%von Willebrand Factor ELISA Kit
<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>Degré de pureté :Min. 95%ANCA combi ELISA kit
<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>Degré de pureté :Min. 95%Human IL10 ELISA Kit
<p>ELISA kit for detection of Human IL10 in the research laboratory</p>Degré de pureté :Min. 95%Parvovirus IgG ELISA kit
<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>Degré de pureté :Min. 95%Mouse MCP1 ELISA kit
<p>ELISA kit for the detection of MCP1 in the research laboratory</p>Degré de pureté :Min. 95%Mouse Vasopressin ELISA kit
<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>Degré de pureté :Min. 95%Human TGFB1 ELISA Kit
<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>Degré de pureté :Min. 95%Human Angiostatin K13 ELISA Kit
<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>Degré de pureté :Min. 95%Phosphatidyl Serine IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%Rat IgG ELISA kit
<p>ELISA Kit for detection of IgG in the research laboratory</p>Degré de pureté :Min. 95%Chlamydia pneumoniae IgG ELISA kit
<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>Degré de pureté :Min. 95%Thyroid peroxidase ELISA kit
<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>Degré de pureté :Min. 95%Human P-Selectin ELISA Kit
<p>ELISA kit for detection of P-Selectin in the research laboratory</p>Degré de pureté :Min. 95%Human IL25 ELISA kit
<p>ELISA Kit for detection of IL25 in the research laboratory</p>Degré de pureté :Min. 95%ASCA IgA/IgG ELISA kit
<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>Degré de pureté :Min. 95%SSA ELISA kit
<p>ELISA kit for the detection of SSA in the research laboratory</p>Degré de pureté :Min. 95%Human AGP ELISA Kit
<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>Degré de pureté :Min. 95%Rituximab Light chain (41-55)
<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>Masse moléculaire :1,620.8 g/molRheumatoid Factor IgA ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>Degré de pureté :Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>Rat NGFb ELISA Kit
<p>ELISA Kit for detection of NGFb in the research laboratory</p>Degré de pureté :Min. 95%Toxoplasma gondii IgG ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>Degré de pureté :Min. 95%Gliadin IgA ELISA kit
<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>Degré de pureté :Min. 95%HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>Rabbit anti Mouse IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Degré de pureté :Min. 95%2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine
CAS :<p>2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine is a human analog that has been found to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes involved in the regulation of cell growth and division. This compound induces apoptosis in Chinese hamster ovary cells and inhibits tumor growth in mice. 2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine has medicinal potential as a cancer therapy due to its ability to inhibit protein kinases that are involved in the development of cancer cells. This compound may be used as a therapeutic agent for various types of cancer, especially those that are resistant to conventional chemotherapy. It has also been detected in human urine, indicating its potential for use as a diagnostic tool for cancer.</p>Formule :C12H20N2ODegré de pureté :Min. 95%Masse moléculaire :208.3 g/molAcetic acid-13C2, d3
CAS :Produit contrôlé<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C2H4O2Degré de pureté :Min. 95%CD30 antibody (FITC)
<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>Degré de pureté :Min. 95%Mouse EGF ELISA Kit
<p>ELISA kit for detection of EGF in the research laboratory</p>Degré de pureté :Min. 95%Dog NGAL ELISA Kit
<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>Degré de pureté :Min. 95%Human Fibronectin ELISA kit
<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>Degré de pureté :Min. 95%FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Degré de pureté :Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Degré de pureté :Min. 95%Human ICAM1 ELISA kit
<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>Degré de pureté :Min. 95%Monkey Hemoglobin ELISA Kit
<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>Degré de pureté :Min. 95%Human HMGB1 ELISA Kit
<p>Human HMGB1(High mobility group protein B1) ELISA Kit</p>Degré de pureté :Min. 95%Human IgM ELISA kit
<p>ELISA Kit for detection of IgM in the research laboratory</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control antibody (Biotin)
<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>Degré de pureté :Min. 95%(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione
CAS :<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>Formule :C36H38O8Degré de pureté :Min. 95%Masse moléculaire :598.7 g/molANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Rat C3 ELISA Kit
<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%SARS-CoV-2 N (IgG) Ab ELISA Kit
<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>Degré de pureté :Min. 95%Human EGFR ELISA Kit
<p>ELISA kit for detection of EGFR in the research laboratory</p>Degré de pureté :Min. 95%Rat IL23 ELISA kit
<p>ELISA Kit for detection of IL23 in the research laboratory</p>Degré de pureté :Min. 95%Decorsin
<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of > 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>Formule :C179H271N55O62S6Degré de pureté :Min. 95%Masse moléculaire :4,377.8 g/molRapalink-1
CAS :<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>Formule :C91H138N12O24Degré de pureté :Min. 95%Masse moléculaire :1,784.1 g/molAngiotensin II (3-8), human
<p>Custom research peptide; min purity 95%.</p>Formule :C40H54N8O8Degré de pureté :Min. 95%Masse moléculaire :774.93 g/molHuman TRAIL ELISA kit
<p>ELISA kit for the detection of TRAIL in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Degré de pureté :Min. 95%Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
<p>Custom research peptide; min purity 95%.</p>Formule :C44H67N9O14Degré de pureté :Min. 95%Masse moléculaire :946.08 g/molRat Lipocalin 2 ELISA Kit
<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>Degré de pureté :Min. 95%Bisoprolol
CAS :<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>Formule :C22H35NO8Degré de pureté :Min. 95%Masse moléculaire :441.50 g/molTSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Degré de pureté :Min. 95%Nucleosome ELISA kit
<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>Degré de pureté :Min. 95%Rat Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%Human IL12 ELISA Kit (p70)
<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>Degré de pureté :Min. 95%Coagulation Factor III ELISA kit
<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>Degré de pureté :Min. 95%LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>Human IgM ELISA Kit
<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rabbit IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Degré de pureté :Min. 95%Human VDPB ELISA Kit
<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Degré de pureté :Min. 95%cAMP ELISA kit
<p>ELISA kit for the detection of cAMP in the research laboratory</p>Degré de pureté :Min. 95%dsDNA IgA ELISA kit
<p>ELISA kit for the detection of dsDNA IgA in the research laboratory</p>Degré de pureté :Min. 95%Human GCSF ELISA kit
<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>Degré de pureté :Min. 95%Mouse CRP ELISA Kit
<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%GBM ELISA kit
<p>ELISA kit for the detection of GBM in the research laboratory</p>Degré de pureté :Min. 95%Mouse MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Degré de pureté :Min. 95%Human SCF ELISA kit
<p>ELISA Kit for detection of SCF in the research laboratory</p>Degré de pureté :Min. 95%Monkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Degré de pureté :Min. 95%Estradiol ELISA kit
<p>ELISA kit for the detection of Estradiol in the research laboratory</p>Degré de pureté :Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Degré de pureté :Min. 95%Dog Red Blood Cells
<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>Degré de pureté :Min. 95%p-Perfluoroterphenyl
CAS :<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>Formule :C18F14Degré de pureté :Min. 95%Masse moléculaire :482.2 g/molHuman MDC ELISA kit
<p>ELISA Kit for detection of MDC in the research laboratory</p>Degré de pureté :Min. 95%Prothrombin IgG/IgM ELISA kit
<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>Toxoplasma gondii IgM ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>Degré de pureté :Min. 95%Parietal Cell ELISA kit
<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>Degré de pureté :Min. 95%Human α 1-Antichymotrypsin ELISA Kit
<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat PPARa ELISA kit
<p>ELISA Kit for detection of PPARa in the research laboratory</p>Degré de pureté :Min. 95%Rat Fibronectin ELISA Kit
<p>ELISA kit for detection of Fibronectin in the research laboratory</p>Degré de pureté :Min. 95%Mouse Oxytocin ELISA kit
<p>ELISA Kit for detection of Oxytocin in the research laboratory</p>Degré de pureté :Min. 95%SNIPER(ABL)-058
CAS :<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>Formule :C62H75N11O9SDegré de pureté :Min. 95%Masse moléculaire :1,150.4 g/molSerotonin ELISA Kit
<p>ELISA kit for detection of Serotonin in the research laboratory</p>Degré de pureté :Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%ssDNA ELISA kit
<p>ELISA kit for the detection of ssDNA in the research laboratory</p>Degré de pureté :Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Degré de pureté :Min. 95%Rheumatoid Factor IgM ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>Degré de pureté :Min. 95%Glucagon (Human, Rat, Mouse)-EIA Kit (1ea)
<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>Degré de pureté :Min. 95%Monkey C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Granzyme B antibody (PE)
<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>CHO LPLA2 ELISA Kit
<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat Histamine ELISA kit
<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>Degré de pureté :Min. 95%Histamine release ELISA kit
<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>Degré de pureté :Min. 95%Human α 1-Antitrypsin ELISA Kit
<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Horse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Degré de pureté :Min. 95%Thymus peptide C
CAS :<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>Degré de pureté :Min. 95%Masse moléculaire :1,000 g/molM13 Phage Titration ELISA Kit
<p>Enzyme Immunoassay for the Quantitative Determination of purified M13 Bacteriophage Particles</p>Degré de pureté :Min. 95%Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>Hamster CHO Legumain ELISA Kit
<p>Hamster (CHO) Legumain ELISA Kit<br>Â <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>Degré de pureté :Min. 95%PEDV Spike Protein - Purified
<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>Degré de pureté :Min. 95%Human Myeloperoxidase (MPO) ELISA Kit
<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%PKCβpseudosubstrate
CAS :<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>Formule :C177H294N62O38S3Degré de pureté :Min. 95%Masse moléculaire :3,995 g/molPig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Degré de pureté :Min. 95%Mouse Leptin ELISA Kit
<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>Degré de pureté :Min. 95%Cat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Degré de pureté :Min. 95%Purified Borrelia burgdorferi OspA Protein
<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>Degré de pureté :Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Degré de pureté :Min. 95%Bovine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%CHO NUCB2 ELISA Kit
<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human HGF ELISA kit
<p>ELISA kit for the detection of Human HGF in the research laboratory</p>Degré de pureté :Min. 95%Mouse IL2 ELISA kit
<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>Degré de pureté :Min. 95%Human TIMP2 ELISA Kit
<p>ELISA kit for detection of TIMP2 in the research laboratory</p>Degré de pureté :Min. 95%PSA ELISA Kit
<p>ELISA kit for detection of PSA in the research laboratory</p>Degré de pureté :Min. 95%Monkey IgG ELISA Kit
<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Histamine in Foodstuffs ELISA kit
<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>Degré de pureté :Min. 95%Amelubant
CAS :<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>Formule :C33H34N2O5Degré de pureté :Min. 95%Masse moléculaire :538.6 g/molMouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%Dog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Degré de pureté :Min. 95%Human VEGF ELISA kit
<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgG3 ELISA Kit
<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog IgM ELISA Kit
<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Degré de pureté :Min. 95%Human IgA ELISA Kit
<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Cat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Degré de pureté :Min. 95%GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Human Prealbumin ELISA Kit
<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molMesotocin trifluroacetate
CAS :<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.19 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molHead activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%
