Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.104 produits)
- Par Biological Target(99.074 produits)
- Par usage/effets pharmacologiques(6.784 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.218 produits)
130576 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HO1, gst tagged human
CAS :<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>Degré de pureté :Min. 95%Chicken IgM ELISA Kit
<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>Degré de pureté :Min. 95%Mouse IL2 ELISA kit
<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>Degré de pureté :Min. 95%Human SAA ELISA Kit
<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Degré de pureté :Min. 95%Human Hemoglobin ELISA Kit
<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog KIM-1 ELISA Kit
<p>Please enquire for more information about Dog KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Haptoglobin ELISA Kit
<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey IgA ELISA Kit
<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Mouse Retinol Binding Protein ELISA Kit
<p>Mouse Retinol Binding Protein ELISA Kit</p>Degré de pureté :Min. 95%Human Apolipoprotein A1 ELISA Kit
<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat CRP ELISA Kit
<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Bovine Haptoglobin ELISA Kit
<p>Please enquire for more information about Bovine Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Ceruloplasmin ELISA Kit
<p>Human Ceruloplasmin ELISA kit is intended for the quantitative determination of total human ceruloplasmin in biological samples.</p>Degré de pureté :Min. 95%Mouse IgE ELISA Kit
<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat A2M ELISA Kit
<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%CHO NUCB2 ELISA Kit
<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgM ELISA Kit
<p>Please enquire for more information about Mouse IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Pig CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Degré de pureté :Min. 95%Dog Albumin ELISA Kit
<p>For the quantitative determination of canine/dog albumin in biological samples.</p>Degré de pureté :Min. 95%Rat B2M ELISA Kit
<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%CHO CTSA ELISA Kit
<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse SAA ELISA Kit
<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%anti-Human Procalcitonin (PCT) Antibody
<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>Degré de pureté :Min. 95%Human AGP ELISA Kit
<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>Degré de pureté :Min. 95%Mouse Ferritin ELISA Kit
<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human α 1-Microglobulin ELISA Kit
<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG2B ELISA Kit
<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat IgA ELISA Kit
<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Hamster CHO Annexin A5 ELISA Kit
<p>Hamster (CHO) Annexin A5 ELISA Kit<br>Â <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>Degré de pureté :Min. 95%Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
<p>Custom research peptide; min purity 95%.</p>Formule :C44H67N9O14Degré de pureté :Min. 95%Masse moléculaire :946.08 g/molC1ORF131 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>Degré de pureté :Min. 95%Human TGFB1 ELISA Kit
<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>Degré de pureté :Min. 95%Influenza A Calibration Kit
<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>Degré de pureté :Min. 95%Mouse IL16 ELISA kit
<p>ELISA Kit for detection of IL16 in the research laboratory</p>Degré de pureté :Min. 95%Parietal Cell ELISA kit
<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>Degré de pureté :Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Human HGF ELISA kit
<p>ELISA kit for the detection of Human HGF in the research laboratory</p>Degré de pureté :Min. 95%Rat PPARa ELISA kit
<p>ELISA Kit for detection of PPARa in the research laboratory</p>Degré de pureté :Min. 95%Influenza A Nucleoprotein ELISA Kit
<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>Degré de pureté :Min. 95%Human β 2 Microglobulin ELISA kit
<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>Degré de pureté :Min. 95%Rheumatoid Factor IgM ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>Degré de pureté :Min. 95%Rat Fibronectin ELISA Kit
<p>ELISA kit for detection of Fibronectin in the research laboratory</p>Degré de pureté :Min. 95%Histamine ELISA Kit
<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>Degré de pureté :Min. 95%Mouse Oxytocin ELISA kit
<p>ELISA Kit for detection of Oxytocin in the research laboratory</p>Degré de pureté :Min. 95%Dihydrotestosterone ELISA Kit
<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>Degré de pureté :Min. 95%Rat Albumin ELISA Kit
<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Pig Haptoglobin ELISA Kit
<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%SNIPER(ABL)-058
CAS :<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>Formule :C62H75N11O9SDegré de pureté :Min. 95%Masse moléculaire :1,150.4 g/molMouse KIM-1 ELISA Kit
<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Recombinant Human PD-ECGF
<p>Human sequence expressed in sf Insect Cells; purity >97% by SDS-PAGE and analyzed by silver stain.</p>Rat AGP ELISA Kit
<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Sheep IgG ELISA Kit
<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>Degré de pureté :Min. 95%Human B2M ELISA Kit
<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Mouse SAP ELISA Kit
<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Guinea Pig IgG ELISA Kit
<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>Degré de pureté :Min. 95%Human LRG1 ELISA Kit
<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>Degré de pureté :Min. 95%Rat Clusterin ELISA Kit
<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Degré de pureté :Min. 95%Human C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Degré de pureté :Min. 95%SLV-2436
CAS :<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>Formule :C19H15ClN4ODegré de pureté :Min. 95%Masse moléculaire :350.8 g/molMouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Degré de pureté :Min. 95%PEDV Nucleocapsid Protein - Purified
<p>This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.</p>Degré de pureté :Min. 95%Insulin, human
<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>Bisoprolol
CAS :<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>Formule :C22H35NO8Degré de pureté :Min. 95%Masse moléculaire :441.50 g/molHamster (CHO) Glutathione S-Transferase P - ELISA Kit
<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>Degré de pureté :Min. 95%(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione
CAS :<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>Formule :C36H38O8Degré de pureté :Min. 95%Masse moléculaire :598.7 g/molMouse MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Degré de pureté :Min. 95%SARS-CoV-2 Spike RBD Antibody Pair 1
<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>Degré de pureté :Min. 95%Human α 1-Antitrypsin ELISA Kit
<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse Cystatin C ELISA Kit
<p>ELISA kit for detection of Cystatin C in the research laboratory</p>Degré de pureté :Min. 95%cAMP ELISA kit
<p>ELISA kit for the detection of cAMP in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgG3 ELISA Kit
<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Triiodothyronine ELISA Kit
<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Human Growth Hormone ELISA Kit
<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>Degré de pureté :Min. 95%Mouse CRP ELISA Kit
<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat Lipocalin 2 ELISA Kit
<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>Degré de pureté :Min. 95%Mots-C
CAS :<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>Formule :C101H152N28O22S2Degré de pureté :Min. 95%Masse moléculaire :2,174.6 g/molFish Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Degré de pureté :Min. 95%Human VEGF ELISA kit
<p>ELISA Kit for detection of VEGF in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Degré de pureté :Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Calcitonin ELISA kit
<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>Degré de pureté :Min. 95%Cortisol ELISA kit
<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>Degré de pureté :Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Degré de pureté :Min. 95%Human Calcitonin ELISA kit
<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>Degré de pureté :Min. 95%Horse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Degré de pureté :Min. 95%Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Cystatin C ELISA kit
<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control antibody (Biotin)
<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>Degré de pureté :Min. 95%Cat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Degré de pureté :Min. 95%ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Degré de pureté :Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Degré de pureté :Min. 95%AMC
CAS :<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END></p>Formule :C10H9NO2Degré de pureté :Min. 95%Masse moléculaire :175.18 g/molHuman Leptin ELISA kit
<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>Degré de pureté :Min. 95%Cat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Degré de pureté :Min. 95%3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol
CAS :<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H84O6Degré de pureté :Min. 95%Masse moléculaire :721.1 g/molDog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Degré de pureté :Min. 95%dsDNA IgM ELISA kit
<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>Degré de pureté :Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Degré de pureté :Min. 95%von Willebrand Factor ELISA Kit
<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>Degré de pureté :Min. 95%ANCA combi ELISA kit
<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>Degré de pureté :Min. 95%Human IL10 ELISA Kit
<p>ELISA kit for detection of Human IL10 in the research laboratory</p>Degré de pureté :Min. 95%Monkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Degré de pureté :Min. 95%SSB ELISA kit
<p>ELISA kit for the detection of SSB in the research laboratory</p>Degré de pureté :Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse MCP1 ELISA kit
<p>ELISA kit for the detection of MCP1 in the research laboratory</p>Degré de pureté :Min. 95%Phospholipid Screen IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%Human BDNF ELISA Kit
<p>ELISA kit for detection of BDNF in the research laboratory</p>Degré de pureté :Min. 95%GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Human VEGFR2 ELISA Kit
<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>Degré de pureté :Min. 95%Rat TrkA ELISA Kit
<p>ELISA kit for detection of TrkA in the research laboratory</p>Degré de pureté :Min. 95%Human IgA ELISA kit
<p>ELISA Kit for detection of IgA in the research laboratory</p>Degré de pureté :Min. 95%Rat Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Degré de pureté :Min. 95%Human IL1 β ELISA kit
<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>Degré de pureté :Min. 95%Gliadin IgA ELISA kit
<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>Degré de pureté :Min. 95%Mouse Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgG1 ELISA Kit
<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human OPN ELISA Kit
<p>ELISA kit for detection of OPN in the research laboratory</p>Degré de pureté :Min. 95%Human IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%CRP ELISA kit
<p>ELISA kit for the detection of CRP in the research laboratory</p>Degré de pureté :Min. 95%2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine
CAS :<p>2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine is a human analog that has been found to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes involved in the regulation of cell growth and division. This compound induces apoptosis in Chinese hamster ovary cells and inhibits tumor growth in mice. 2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine has medicinal potential as a cancer therapy due to its ability to inhibit protein kinases that are involved in the development of cancer cells. This compound may be used as a therapeutic agent for various types of cancer, especially those that are resistant to conventional chemotherapy. It has also been detected in human urine, indicating its potential for use as a diagnostic tool for cancer.</p>Formule :C12H20N2ODegré de pureté :Min. 95%Masse moléculaire :208.3 g/molHuman Lactoferrin ELISA Kit
<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control Fc fusion protein (PE)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>Degré de pureté :Min. 95%Toxoplasma gondii IgG ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>Degré de pureté :Min. 95%Rat Haptoglobin ELISA Kit
<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Plasminogen ELISA Kit
<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Degré de pureté :Min. 95%[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/molHead activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%Prolactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/mol
