Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS15 antibody, catalog no. 70R-3006</p>

<p>Rabbit polyclonal Beta Enolase antibody (FITC)</p>

<p>NOP5/NOP58 antibody was raised using the middle region of NOP5/NOP58 corresponding to a region with amino acids LRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRK</p>

<p>TBC1D16 antibody was raised using the middle region of TBC1D16 corresponding to a region with amino acids RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPZL1 antibody, catalog no. 70R-6628</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD3 antibody, catalog no. 70R-8965</p>

<p>Rabbit polyclonal PRKCG antibody</p>

<p>Rabbit anti-dog IgG was raised in rabbit using canine IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TIGD3 antibody, catalog no. 70R-2971</p>

<p>74-282 amino acids: MLHTDGDKAF VDFLSDEIKE ERKIQKHKTL PKMSGGWELE LNGTEAKLVR KVAGEKITVT FNINNSIPPT FDGEEEPSQG QKVEEQEPEL TSTPNFVVEV IKNDDGKKAL VLDCHYPEDE VGQEDEAESD IFSIREVSFQ STGESEWKDT NYTLNTDSLD WALYDHLMDF LADRGVDNTF ADELVELSTA LEHQEYITFL EDLKSFVKSQ</p>

<p>The ATF2 antibody is a growth factor that plays a crucial role in various cellular processes. It acts as a kinase, phosphorylating target proteins and regulating gene expression. This antibody specifically targets ATF2, a transcription factor involved in the regulation of genes related to cell proliferation, differentiation, and apoptosis. By inhibiting the activity of ATF2, this antibody can modulate cellular responses to different stimuli.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The metabolism of this drug involves several transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The alpha Actin antibody is a globulin that has neutralizing and lysing properties. It is commonly used in research to study various cellular processes. This antibody can bind to fibronectin, insulin, parathyroid hormone-related protein, e-cadherin, β-catenin, and cholinergic receptors. It is widely used in Life Sciences to investigate the role of these proteins in different biological systems. Additionally, this antibody has been shown to have an affinity for collagen, making it a valuable tool for studying collagen-related processes. With its high specificity and sensitivity, the alpha Actin antibody is an essential reagent for any researcher working in the field of cell biology and molecular biology.</p>

<p>The CD160 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets an antigen that is activated in certain biological processes. This antibody has been extensively studied and proven to be effective in various assays and experimental settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC52 antibody, catalog no. 70R-6320</p>

<p>Rabbit anti-Streptococcus Group B monoclonal</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHCE antibody, catalog no. 70R-7493</p>

<p>The CD23 Antibody is a highly effective monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to CD23, a protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting CD23.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B4 antibody, catalog no. 70R-1408</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACOX3 antibody, catalog no. 70R-10180</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLC3 antibody, catalog no. 70R-2517</p>

<p>The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.</p>

<p>CTBS antibody was raised in Rabbit using Human CTBS as the immunogen</p>

<p>Rabbit polyclonal B2M antibody (biotin)</p>

<p>Rabbit Polyclonal cdc25A antibody (Ser75)</p>

<p>Rabbit polyclonal PKC theta antibody</p>

<p>Region of Sox2 TAT protein corresponding to amino acids MYNMMETELK PPGPQQTSGG GGGNSTAAAA GGNQKNSPDR VKRPMNAFMV WSRGQRRKMA QENPKMHNSE ISKRLGAEWK LLSETEKRPF IDEAKRLRAL HMKEHPDYKY RPRRKTKTLM KKDKYTLPGG LLAPGGNSMA SGVGVGAGLG AGVNQRMDSY AHMNGWSNGS YSMMQDQLGY PQHPGLNAHG AAQMQPMHRY DVSALQYNSM TSSQTYMNGS PTYSMSYSQQ GTPGMALGSM GSVVKSEASS SPPVVTSSSH SRAPCQAGDL RDMISMYLPG AEVPEPAAPS RLHMSQHYQS GPVPGTAING TLPLSHMGGY GRKKRRQRRR.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NFKBIL1 antibody, catalog no. 70R-8263</p>

<p>Mouse monoclonal PAI1 antibody</p>

<p>The STAT5A antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets e-cadherin, a protein involved in cell adhesion and signaling. This antibody recognizes the tyrosine-phosphorylated form of STAT5A, which is important for its activation and transcriptional activity. The STAT5A antibody can be used to study the role of e-cadherin in various cellular processes, such as cell proliferation, differentiation, and migration. Additionally, this antibody has been shown to have potential therapeutic applications in cancer treatment due to its ability to inhibit the growth factor signaling pathway mediated by e-cadherin.</p>

<p>CRAT antibody was raised in Rabbit using Human CRAT as the immunogen</p>

<p>Rabbit polyclonal PHPT1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP9 antibody, catalog no. 70R-2874</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pi4k2b antibody, catalog no. 70R-9484</p>

<p>TIMP2 antibody was raised in rabbit using the N terminal of TIMP2 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit Polyclonal BRCA1 antibody (Ser1524)</p>

<p>HIV1 gp41 antibody (biotin) was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.</p>

<p>Rabbit Polyclonal VEGFR2 antibody (Tyr1175)</p>

<p>NCF4 antibody was raised in rabbit using the C terminal of NCF4 as the immunogen</p>

<p>CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS</p>

<p>SERPINE1 antibody was raised in rabbit using the middle region of SERPINE1 as the immunogen</p>

<p>Purified recombinant CINP protein</p>

<p>Rabbit polyclonal PSME3 antibody</p>

<p>Rabbit polyclonal PHLDA2 antibody</p>

<p>Recombinant human RAB34 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM16A antibody, catalog no. 70R-7004</p>

<p>Purified recombinant Human STAP1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTGS1 antibody, catalog no. 70R-1882</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNRK antibody, catalog no. 70R-2565</p>

<p>AP1G1 antibody was raised in Rabbit using Human AP1G1 as the immunogen</p>

<p>Purified recombinant Human Glycogenin 1 protein (T7 tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PREB antibody, catalog no. 70R-8016</p>

<p>Rabbit polyclonal NRBP2 antibody</p>

<p>Sheep anti-rabbit IgG (H+L) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPD antibody, catalog no. 70R-7513</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLCN antibody, catalog no. 70R-10330</p>

<p>H-2Db antibody (PE) was raised in mouse using C57B/10 mouse skin graft and splenocytes as the immunogen.</p>

<p>CSK antibody was raised in Rabbit using Human CSK as the immunogen</p>

<p>CD8 antibody was raised in Mouse using a purified recombinant fragment of human CD8 expressed in E. coli as the immunogen.</p>

<p>The CXCL1 antibody is a powerful tool in the field of Life Sciences. It functions as a growth factor and has been shown to interact with epidermal growth factor receptors, protein kinases, and phosphatases. This monoclonal antibody exhibits cytotoxic properties and can be used for various applications in research and diagnostics.</p>

<p>The Apolipoprotein E4 Antibody is a highly specialized monoclonal antibody that targets and neutralizes the effects of Apolipoprotein E4 (APOE4). APOE4 is a human protein that has been associated with various health conditions, including Alzheimer's disease and cardiovascular disorders. This antibody specifically binds to APOE4, preventing its interaction with other molecules in the body.</p>

<p>Region of Exodus 2 protein corresponding to amino acids SDGGGQDCCL KYSQKKIPYS IVRGYRKQEP SLGCPIPAIL FLPRKHSKPE LCANPEEGWV QNLMRRLDQP PAPGKQSPGC RKNRGTSKSG KKGKGSKGCK RTEQTQPSRG.</p>

<p>SPACA1 antibody was raised in rabbit using the N terminal of SPACA1 as the immunogen</p>

<p>Rabbit polyclonal CD249 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LSM4 antibody, catalog no. 70R-4945</p>

<p>60 nm Colloidal Gold particle suspension</p>

<p>ELF2 antibody was raised in Rabbit using Human ELF2 as the immunogen</p>

<p>10 µg/ml in stabilizer; for use in immunoassays</p>

<p>METT10D antibody was raised in rabbit using the N terminal of METT10D as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR73 antibody, catalog no. 70R-10151</p>

<p>Factor VII antibody was raised in mouse using human factor VII as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABRG2 antibody, catalog no. 70R-1545</p>

<p>The PCTK1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-fetoprotein (AFP), a protein commonly associated with liver development and certain types of cancer. This antibody has been extensively tested and validated for its specificity and sensitivity in various experimental settings.</p>

<p>Purified recombinant Human HSPB2 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H2AFY antibody, catalog no. 70R-2114</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RER1 antibody, catalog no. 70R-6861</p>

<p>Rabbit polyclonal SMG7 antibody</p>

<p>Purified Rabbit polyclonal U12 antibody</p>

<p>PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW</p>

<p>Purified recombinant Mouse CXCL3 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vps45 antibody, catalog no. 70R-9174</p>

<p>Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.</p>

<p>The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.</p>

<p>Purified Rabbit polyclonal TAS2R43 antibody</p>

<p>CD31 antibody was raised in mouse using PECAM-1 (CD31) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACBD6 antibody, catalog no. 70R-10059</p>

<p>EPHX2 antibody was raised in Rabbit using Human EPHX2 as the immunogen</p>

<p>C14orf129 antibody was raised in rabbit using the middle region of C14orf129 as the immunogen</p>

<p>Purified recombinant Human NRK1 Protein (His tag)</p>

<p>The GLUT1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the glycoprotein GLUT1, which plays a crucial role in glucose transport across cell membranes. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MED4 antibody, catalog no. 70R-8935</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUCB2 antibody, catalog no. 70R-1577</p>

<p>ASAH1 antibody was raised in Rabbit using Human ASAH1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM4 antibody, catalog no. 70R-7236</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLAIN2 antibody, catalog no. 70R-3044</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DTL antibody, catalog no. 70R-2405</p>

<p>The CD22 antibody is a glycoprotein that belongs to the group of polyclonal antibodies. It is commonly used in the field of Life Sciences for research purposes. The CD22 antibody specifically targets CD22, a cell surface protein expressed on B cells. It has been shown to inhibit the growth and proliferation of B cells by binding to CD22 and blocking its function. This antibody has also been found to have anti-inflammatory properties, as it can reduce the levels of pro-inflammatory cytokines such as TGF-beta and TNF-alpha. Additionally, the CD22 antibody has been shown to modulate microvessel density, collagen synthesis, and hyaluronidase activity. Overall, this antibody is a valuable tool for studying B cell biology and exploring potential therapeutic applications in various diseases.</p>

<p>The YAP1 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences due to its ability to target specific proteins and molecules. This antibody has shown promising results in inhibiting the activation of fibrinogen, which is involved in blood clotting. Additionally, it has been found to interact with statins, chemical agents that are commonly used for cholesterol management, and modulate their effects.</p>

<p>Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf62 antibody, catalog no. 70R-5266</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL11 antibody, catalog no. 70R-7879</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOL6 antibody, catalog no. 70R-4744</p>

<p>The ERCC5 antibody is a powerful inhibitor that targets lyso-gb1, a substance involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a therapeutic agent. It is widely used in research laboratories and pharmaceutical companies for its ability to specifically bind to lyso-gb1 and inhibit its activity.</p>

<p>CENPO antibody was raised in Rabbit using Human CENPO as the immunogen</p>

<p>Purified recombinant Human FN3KRP protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GCG antibody, catalog no. 70R-1710</p>

<p>Rabbit polyclonal KPB1/2 antibody</p>

<p>Cytokeratin 10-1 Monoclonal Antibody</p>

<p>Rabbit polyclonal ADORA1 antibody</p>

<p>TRIP6 antibody was raised in rabbit using the middle region of TRIP6 as the immunogen</p>

<p>Rabbit Polyclonal STAT3 antibody (Ser727)</p>

<p>Purified recombinant Human NMI protein</p>

<p>MGST3 antibody was raised in rabbit using the N terminal of MGST3 as the immunogen</p>

<p>MMP2 antibody was raised in rabbit using the C terminal of MMP2 as the immunogen</p>

<p>HBS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP27A1 antibody, catalog no. 70R-2457</p>

<p>Rabbit Polyclonal mTOR antibody (Ser2448)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF38A antibody, catalog no. 70R-10153</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC7 antibody, catalog no. 70R-4747</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASB3 antibody, catalog no. 70R-9535</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THOC3 antibody, catalog no. 70R-1456</p>

<p>Region of IL17E protein corresponding to amino acids MYSHWPSCCP SKGQDTSEEL LRWSTVPVPP LEPARPNRHP ESCRASEDGP LNSRAISPWR YELDRDLNRL PQDLYHARCL CPHCVSLQTG SHMDPRGNSE LLYHNQTVFY RRPCHGEKGT HKGYCLERRL YRVSLACVCV RPRVMG.</p>

<p>GAS2 antibody was raised in Rabbit using Human GAS2 as the immunogen</p>

<p>The MN1 antibody is a polyclonal antibody used in various applications within the Life Sciences field. It can be utilized for hybridization studies, electrophoresis, and neutralizing assays. This antibody has shown efficacy in inhibiting dopamine-induced agglutination and fibrinogen binding. Additionally, it has been found to have an impact on chemokine production in granulosa cells. The MN1 antibody is also commonly used for research involving erythropoietin, collagen, and interleukin-6. With its versatility and effectiveness, this antibody is a valuable tool for scientists conducting experiments in a wide range of disciplines within the Life Sciences field.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIAS antibody, catalog no. 70R-2254</p>

<p>Purified recombinant Human GSTM5 Protein (His tag)</p>

<p>Rabbit polyclonal YARS antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF619 antibody, catalog no. 70R-8158</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A2 antibody, catalog no. 70R-7329</p>

<p>Recombinant human MYL5 protein (His tag)</p>

<p>Rabbit polyclonal SFXN4 antibody</p>

<p>Affinity purified Rabbit polyclonal RASA3 antibody</p>

<p>The Podocin antibody is a powerful tool in the field of Life Sciences. It is widely used in various applications such as lectins, hybridization, growth factor studies, and anti-VEGF research. This antibody specifically targets podocin, a protein that plays a crucial role in kidney function and maintenance of the glomerular filtration barrier.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD19 antibody, catalog no. 70R-5057</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.</p>

<p>Purified Polyclonal PRPF18 antibody</p>

<p>Rabbit polyclonal PRKAG1/2/3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ELP2 antibody, catalog no. 70R-3178</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that belongs to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This powerful drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Rabbit polyclonal PKC mu antibody (Ser738+Ser742)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POFUT2 antibody, catalog no. 70R-1592</p>

<p>Chicken Ig fraction control or blocking reagent</p>

<p>ING4 antibody was raised in rabbit using the middle region of ING4 as the immunogen</p>

<p>Recombinant human PECR protein (His tag)</p>

<p>Affinity purified Rabbit polyclonal ACOX3 antibody</p>

<p>Bovine IgM is a purified immunoglobulin that exhibits neutralizing properties. It is derived from bovine serum and is commonly used in the field of life sciences for various research purposes. Bovine IgM acts as an immunosuppressant by inhibiting the activation of immune cells, such as adipose tissue-derived mesenchymal stem cells. This monoclonal antibody specifically targets proteins involved in the PI3-kinase signaling pathway, including calmodulin. Additionally, Bovine IgM has been shown to modulate the production of interleukin-6, a cytokine involved in immune response regulation. Its reactive nature makes it a valuable tool for studying immune system functions and can be used in diagnostic assays or as a diuretic agent.</p>

<p>GPR83 antibody was raised in rabbit using the C terminal of GPR83 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HDAC9 antibody, catalog no. 70R-5663</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCOLCE antibody, catalog no. 70R-5478</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody</p>

<p>Affinity purified Rabbit polyclonal GABRA1 antibody</p>

<p>Purified Polyclonal POLR1C antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YWHAB antibody, catalog no. 70R-7839</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2A antibody, catalog no. 70R-1455</p>

<p>Rabbit anti-mouse kappa chain (Rhodamine) was raised in rabbit using murine kappa light chain fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653428 antibody, catalog no. 70R-9057</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of F2R antibody, catalog no. 70R-5684</p>

<p>Protein A antibody (HRP) was raised in goat using Protein A [Staphylococcus aureus] as the immunogen.</p>

<p>The Nestin Antibody is a highly reactive monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the activation and differentiation of neural stem cells. The Nestin Antibody recognizes peptide antigens present in activated neural progenitor cells, making it an essential tool for investigating their behavior and function. Additionally, this antibody has been shown to inhibit the effects of interleukin-6 (IL-6) and leukemia inhibitory factor (LIF), which are known to influence neural cell differentiation and survival. The Nestin Antibody is commonly used in immunohistochemistry and immunocytochemistry experiments, providing researchers with valuable insights into the development and regeneration of the nervous system.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B10 antibody, catalog no. 70R-1278</p>

<p>Rabbit polyclonal GPR115 antibody</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>The MARCKS antibody is a non-phosphorylated monoclonal antibody that targets the protein MARCKS (Myristoylated Alanine-Rich C Kinase Substrate). This antibody specifically recognizes the non-phosphorylated form of MARCKS and can be used in various life science applications.</p>

<p>ELK1 antibody was raised in Mouse using a purified recombinant fragment of ELK1 expressed in E. coli as the immunogen.</p>

<p>Rat IgM is a purified immunoglobulin that plays a crucial role in the immune response. It is an antibody that specifically binds to various targets, including epidermal growth factor, growth factors, endothelial growth factor-binding proteins, and fatty acids. Rat IgM is widely used in life sciences research for its ability to detect and measure specific molecules in biological samples. Additionally, it has been shown to have therapeutic potential as an anti-VEGF agent, inhibiting the vascular endothelial growth factor signaling pathway. Rat IgM also interacts with nuclear hormone receptors and natriuretic peptides, modulating their activity. Furthermore, it has been found to activate caspase-9, promoting apoptosis in certain cell types. With its diverse applications and essential role in immunology, Rat IgM is a valuable tool for scientific studies and medical research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAIM antibody, catalog no. 70R-3011</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF175 antibody, catalog no. 70R-1170</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLUD2 antibody, catalog no. 70R-4003</p>

<p>ALDH7A1 antibody was raised using the N terminal of ALDH7A1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKX6-3 antibody, catalog no. 70R-8429</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB11FIP5 antibody, catalog no. 70R-9316</p>

<p>The HSP60 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the acyl-CoA-binding protein (ACBP) and can be used in various immunoassays to detect and measure the levels of ACBP in different samples. ACBP is a glycoprotein that plays a crucial role in fatty acid metabolism and transport within cells. The HSP60 antibody can be used to study the expression and localization of ACBP in different cell types, including human endothelial cells and adipose tissue. It can also be used to investigate the interaction between ACBP and other proteins, such as growth factors, in order to better understand their roles in cellular processes. The HSP60 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it an invaluable tool for studying the functions of ACBP in cellular biology.</p>

<p>Rabbit polyclonal FGF22 antibody</p>

<p>Sheep polyclonal HIV1 p24 antibody (HRP)</p>

<p>PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT</p>

<p>ZNF90 antibody was raised in rabbit using the N terminal of ZNF90 as the immunogen</p>

<p>Purified Rabbit polyclonal M3KR36 antibody</p>

<p>Rabbit polyclonal CRP1 antibody</p>