Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.129 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.742 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Dendroaspis Natriuretic Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C180H282N56O56S2Masse moléculaire :4,190.72 g/molPKA Inhibitor Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/molVIP (1-12), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H88N18O22Masse moléculaire :1,425.49 g/molβ-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H173N27O29SMasse moléculaire :2,393.86 g/mol[Tyr12]-Somatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H107N23O20SMasse moléculaire :1,562.78 g/molAcyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H74N12O16Masse moléculaire :1,063.18 g/molα-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C18H33N5O4Masse moléculaire :383.49 g/molAllatostatin VII
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H69N13O13SMasse moléculaire :1,044.2 g/molParallel topology β-Amyloid modified peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H150N24O38S2Masse moléculaire :2,504.71 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H85N13O18S2Masse moléculaire :1,376.60 g/molAc-β-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N42O45SMasse moléculaire :3,479.99 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H64N12O19Masse moléculaire :1,005.01 g/molLeucopyrokinin (LPK)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N12O12Masse moléculaire :931.06 g/molβ-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C23H28N4O4Masse moléculaire :424.50 g/molBiotin-Calcitonin (salmon I)
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H254N46O50S3Masse moléculaire :3,658.22 g/mol[Tyr0]-pTH-Related Protein (1-34) (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C189H296N58O50Masse moléculaire :4,180.79 g/molWWamide-3
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H66N12O9SMasse moléculaire :963.18 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H52N10O13Masse moléculaire :880.92 g/molKinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27PMasse moléculaire :1,702.77 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H172N24O30Masse moléculaire :2,310.74 g/molβ-Casomorphin (1-5) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/molIL-8 Inhibitor
CAS :<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>Formule :C45H66N18O7SDegré de pureté :Min. 95%Masse moléculaire :1,003.19 g/molMBP (90-106), phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H141N25O22Masse moléculaire :1,913.27 g/mol[Tyr0] Gastric Inhibitory Peptide (23-42), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H182N34O31Masse moléculaire :2,584.92 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formule :C22H36N8O11Masse moléculaire :588.58 g/molCEA Related, QYSWFVNGTF
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H77N13O16Masse moléculaire :1,248.37 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molChorionic Gonadotropin-β(109-119) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H76N16O21SMasse moléculaire :1,269.31 g/molMMP-7 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H77N17O14Masse moléculaire :1,164.31 g/molBiotin-CRF (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C218H358N62O65S3Masse moléculaire :4,983.85 g/mol[Des-Tyr1]-β-Endorphin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H242N38O44SMasse moléculaire :3,301.88 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H227N35O44SMasse moléculaire :3,136.64 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Tyr4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H85N21O18Masse moléculaire :1,328.42 g/molPro-Adrenomedullin N20, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H178N36O26Masse moléculaire :2,444.83 g/molBiotin-Galanin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H224N44O45SMasse moléculaire :3,383.78 g/molCalcitonin C-terminal Adjacent Peptide, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H117N23O27SMasse moléculaire :1,889.05 g/molβ-Lipotropin (1-10), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H66N10O15Masse moléculaire :951.05 g/mol[Leu144]-PLP (139-151), L144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H105N19O17Masse moléculaire :1,448.70 g/molDynorphin (2-17), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C90H147N31O20Masse moléculaire :1,983.37 g/molBax-BH3L63A
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H129N22O27SMasse moléculaire :1,791.05 g/mol[Lys8,Asn9] Neurotensin LANT-6 (8-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H58N8O9Masse moléculaire :746.91 g/molCalmodulin-Dependent Protein Kinase II (281-309)
<p>Catalogue peptide; min. 95% purity</p>Formule :C146H254N46O39S3Masse moléculaire :3,374.05 g/molPACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Formule :C204H333N63O53SMasse moléculaire :4,548.38 g/mol[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H64N14O10S2Masse moléculaire :1,013.22 g/mol[Phe2]-TRH
<p>Catalogue peptide; min. 95% purity</p>Formule :C19H24N4O4Masse moléculaire :372.44 g/molMARCKS Protein (151-175)
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H243N41O31Masse moléculaire :3,080.83 g/mol[D-Trp2,7,9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H109N21O13SMasse moléculaire :1,604.96 g/molPrepro-Nerve Growth Factor (99-115) (mouse)
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H139N27O26Masse moléculaire :2,003.25 g/molBPDEtide [RKISASEFDRPLR]
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H115N23O20Masse moléculaire :1,574.82 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H77N21O12Masse moléculaire :1,068.22 g/molDAP10 Signaling Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H118N22O24SMasse moléculaire :1,731.96 g/molGLP-2 (1-33) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C165H254N44O55SMasse moléculaire :3,766.1 g/molBNP-45 ,rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C213H349N71O65S3Masse moléculaire :5,040.79 g/mol[Arg8]-a-Neo-Endorphin (1-8)
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H73N15O10Masse moléculaire :996.19 g/molIL-8 (-5 to +5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N14O14Masse moléculaire :1,083.31 g/molPKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C92H151N28O32PMasse moléculaire :2,192.39 g/molFmoc-Mating Factor a
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H125N20O19SMasse moléculaire :1,907.26 g/mol[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H87N15O22S3Masse moléculaire :1,430.61 g/molC-terminal Proghrelin Isoform Peptide, mouse
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H86N22O17Masse moléculaire :1,267.38 g/molEcdysis-Triggering Hormone (Manduca sexta)
<p>Catalogue peptide; min. 95% purity</p>Formule :C127H206N36O38S3Masse moléculaire :2,941.45 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H126N26O21S2Masse moléculaire :1,864.2 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H147N29O24SMasse moléculaire :2,135.50 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/molVA-β-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H188N36O37SMasse moléculaire :2,831.19 g/molLF 20 Consensus Peptide. Anthrax Related Lethal Factor
<p>Catalogue peptide; min. 95% purity</p>Formule :C106H173N29O27S2Masse moléculaire :2,349.87 g/molMyelopeptide-2 (MP-2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H57N7O8Masse moléculaire :776 g/molMMP-2/MMP-9 Inhibitor III
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H73N13O14S2Masse moléculaire :1,168.35 g/molH-Pro-Phe-OH
CAS :<p>H-Pro-Phe-OH is a synthetic peptide that is used in the treatment of high blood pressure. It has been shown to decrease blood pressure by increasing the production of nitric oxide and by decreasing activity of angiotensin converting enzyme, which are factors that have an influence on blood pressure. H-Pro-Phe-OH has been shown to be effective for treating HIV infection and amyloidosis. H-Pro-Phe-OH binds to collagen and increases its production in tissues, which may be responsible for its antihypertensive effects. It also inhibits the growth of bacteria by binding to their cell walls and inhibiting their protein synthesis. The metabolic products of H-Pro-Phe-OH are not yet known, but it is thought that they may contain hydroxyproline or hydroxylysine residues.</p>Formule :C14H18N2O3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :262.3 g/molTax8, HTLV-1 (12-19)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H68N8O11Masse moléculaire :957.15 g/molGIP, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C225H342N60O66SMasse moléculaire :4,975.66 g/molβ-Amyloid (16-26)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H86N12O17Masse moléculaire :1,211.39 g/molIntermedin (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H351N69O66S3Masse moléculaire :5,102.84 g/molGlucagon-Like Peptide 1, (GLP-1) amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C184H273N51O57Masse moléculaire :4,111.53 g/mol[Arg91, Ala96]-MBP (87-99), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H112N22O17Masse moléculaire :1,557.83 g/mol[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H121N23O20Masse moléculaire :1,652.93 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H85N14O13SMasse moléculaire :1,087.35 g/mol[Tyr63] PTH (63-84), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H172N28O37Masse moléculaire :2,394.68 g/molPep 4AK
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H153N27O19Masse moléculaire :1,809.29 g/molAdrenomedullin (1-12), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H100N22O19SMasse moléculaire :1,513.7 g/mol[D-Pro2]-β-Casomorphin (1-5) ,bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H37N5O7Masse moléculaire :579.66 g/molH-Glu-Glu-OH
CAS :<p>H-Glu-Glu-OH is an organic acid that has proteolytic and gene product properties. It is a hyperactive compound that can be used as a sample preparation reagent for the detection of glutamic acid in proteins. H-Glu-Glu-OH inhibits protein synthesis by binding to ribosomes, which are responsible for the production of proteins in the cell, and prevents their function. Magnetic resonance spectroscopy has been used to investigate the uptake of H-Glu-Glu-OH into mammalian cells and ovarian follicles.</p>Formule :C10H16N2O7Degré de pureté :Min. 95 Area-%Couleur et forme :White PowderMasse moléculaire :276.24 g/mol[D-Pro2]-β-Casomorphin (1-5) , bovine, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H38N6O6Masse moléculaire :578.7 g/mol[Ala9,10, Lys11,12] Glycogen Synthase (1-12)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H103N17O16Masse moléculaire :1,270.7 g/molγ-2-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H100N22O15SMasse moléculaire :1,569.82 g/molFmoc-Tyr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-Ala-Ala-bNA
CAS :<p>Ala-Ala-bNA is a substrate for dipeptidyl aminopeptidase I (cathepsin C)</p>Formule :C16H19N3O2Degré de pureté :Min. 99 Area-%Couleur et forme :White PowderMasse moléculaire :285.34 g/molInfluenza HA (210-219)
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H74N10O17Masse moléculaire :1,027.15 g/molγ-TAC4 (30-61)-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H242N40O49SMasse moléculaire :3,481.96 g/molSRC-1 (682-697)
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H142N28O22Masse moléculaire :1,872.22 g/molγ-MSH (3-8)
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H52N12O7SMasse moléculaire :832.98 g/molα-Conotoxin SIA
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H82N18O17S4Masse moléculaire :1,455.7 g/molDecorsin, Leech
<p>Catalogue peptide; min. 95% purity</p>Formule :C179H277N55O62S6Masse moléculaire :4,383.87 g/molβ-Casomorphin, bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H55N7O9Masse moléculaire :789.94 g/molDok-6 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H113N25O18Masse moléculaire :1,664.90 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molLuteinizing Hormone-Releasing Hormone, free acid, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H81N17O16SMasse moléculaire :1,304.45 g/molVal-Asp-(Arg8)-Vasopressin
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H79N17O16S2Masse moléculaire :1,298.48 g/molBiotin-VIP (human, bovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N46O44S2Masse moléculaire :3,552.17 g/molAc-[Nle4,DPhe7] a-MSH (4-10), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H64N14O10Masse moléculaire :985.12 g/molConantokin T, Marine snail, Conus tullpa
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H175N31O45SMasse moléculaire :2,683.81 g/molβ-Amyloid (32-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C19H36N4O5SMasse moléculaire :432.59 g/mol[Pyr16]-VIP (16-28) (chicken)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H113N17O18SMasse moléculaire :1,476.83 g/molHCV NS4A Protein (22-33) (FDA strain)
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H98N15O14SMasse moléculaire :1,213.54 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H41N5O12Masse moléculaire :723.7 g/molPergolide mesylate
CAS :Produit contrôlé<p>D1 and D2 dopamine agonist</p>Formule :C20H30N2O3S2Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :410.6 g/molSteroid Receptor Co-Factor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H136N26O21Masse moléculaire :1,786.13 g/molgp100 (639-647)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H79N15O11S2Masse moléculaire :1,094.36 g/molMBP (90-106)
<p>Catalogue peptide; min. 95% purity</p>Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molDynorphin A amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H156N32O22Masse moléculaire :2,146.55 g/molTRH-SH Pro
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H85N21O12S2Masse moléculaire :1,212.46 g/mol2B/3, Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H58N14O12Masse moléculaire :949.09 g/molLHRH-Ⅲ, lamprey
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H75N18O14Masse moléculaire :1,259.4 g/molProinsulin C-peptide (55-89), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C153H259N49O52Masse moléculaire :3,616.98 g/molBiotin-LC-Neurogranin (28-43)
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H159N31O20S2Masse moléculaire :2,139.48 g/molBiotin-MBP Derivatized Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H166N28O25Masse moléculaire :2,252.73 g/mol[D-Asp1]-Amyloid-β-Protein (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C203H311N55O60SMasse moléculaire :4,514.14 g/mol[Tyr0]-Neurokinin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H88N14O16S2Masse moléculaire :1,373.63 g/molPrésure. 10. 145-148
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H59N7O12Masse moléculaire :902.02 g/molβ-Lipotropin (61-64)
<p>Catalogue peptide; min. 95% purity</p>Formule :C22H26N4O6Masse moléculaire :442.48 g/molβ-Amyloid/A4 Protein Precusor (APP) (319-335)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H151N31O26S2Masse moléculaire :2,099.48 g/mol[Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Pyr11]-Amyloid β-Protein (11-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molβ-Amyloid(1-16), mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H116N26O26Masse moléculaire :1,857.98 g/molβ-Endorphin (1-27), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C139H217N33O40SMasse moléculaire :3,022.54 g/mol[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H68N14O10Masse moléculaire :1,109.3 g/molBiotin-Phosphorylated MBP (94-102)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H85N20O15SMasse moléculaire :1,273.41 g/molMMP-3 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H61N13O13SMasse moléculaire :1,012.13 g/molInfluenza A M2 coat protein (22-46)
<p>Catalogue peptide; min. 95% purity</p>Formule :C129H215N31O33Masse moléculaire :2,728.34 g/molCaspase 3 Substrate, chromogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C27H39N7O10Masse moléculaire :621.66 g/molTNF-α(10-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C131H211N43O38Masse moléculaire :2,996.41 g/molOrcokinin
CAS :<p>Orcokinin H-Asn-Phe-Asp-Glu-Ile-Asp-Arg-Ser-Gly-Phe-Gly-Phe is a peptide that was synthesized in the laboratory. It has been shown to have receptor activity and to stimulate locomotor activity in experimental models. Orcokinin H is a member of the family of peptide hormones that are present in mammals. The peptide sequence contains six amino acids, four of which are hydrophobic and two polar, with a single hydroxyl group. These features make this molecule an excellent candidate for use as a model system for studying amyloid protein aggregation and its physiological function.</p>Formule :C67H92N18O23Degré de pureté :Min. 95%Masse moléculaire :1,517.55 g/molEGF Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H100N15O26PMasse moléculaire :1,622.68 g/molβ-Amyloid/A4 Protein Precursor (APP) (96-110), analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/molHepatitis Virus C NS3 Protease Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H45N6O16S2Masse moléculaire :796.8 g/molLeptin Receptor Precursor
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H94N13O19PMasse moléculaire :1,332.49 g/molSU086
CAS :<p>Chalcone compound that decreases HSP90 levels and inhibits prostate cancer cell growth and migration in vitro</p>Formule :C18H17NO6Masse moléculaire :343.33 g/molPeptide M
CAS :<p>Peptide M is a synthetic peptide made up of the amino acid sequence: DTNLASSTIIKEGIDKTV. It is an immunogenic component corresponding to amino acids 303-320 of the photoreceptor cell protein, retinal S-antigen. During studies, it has been found to induce experimental autoimmune uveitis (EAU) in animals which is a T-cell mediated disease causing retina, pineal gland and uveal tract inflammation. EAU successfully models ocular autoimmune diseases such as birdshot retinochoroidopathy and sympathetic ophthalmia. Therefore peptide M can be used in research into these diseases.<br>Structural studies have demonstrated peptide M to form macromolecular assemblies and then an intermolecular beta-sheet structure between a pH range of 4-9.5. It has been suggested, that when the peptide M adopts the monomeric state its structure and beta sheets become disordered. It is also thought that through its extended beta-type conformation peptide M is able to position itself between the major histocompatibility complex and the T-cell receptor.</p>Formule :C81H141N21O31Degré de pureté :Min. 95%Masse moléculaire :1,905.11 g/molAc-β-Endorphin (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C160H253N39O47SMasse moléculaire :3,507.01 g/mol[Tyr8]-Atrial Natriuretic Peptide (5-27), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C98H156N34O33S2Masse moléculaire :2,402.62 g/mol[Des-Leu9]-Kinetensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H74N16O10Masse moléculaire :1,059.25 g/molSIVmac251 (gp140) Fragment (171-190) [Cys]
<p>Catalogue peptide; min. 95% purity</p>Formule :C118H180N30O35S2Masse moléculaire :2,642.99 g/molCathepsin G (77-83)
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H59N15O12Masse moléculaire :942.01 g/molMSP-1 (20-39), Merozoite Surface Peptide 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C102H165N25O35Masse moléculaire :2,301.60 g/molβ-Amyloid (7-22)
<p>Catalogue peptide; min. 95% purity</p>Formule :C88H124N22O26Masse moléculaire :2,466 g/mol[Tyr43] PTH (43-68) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H208N42O43Masse moléculaire :2,999.32 g/molFmoc-Asn(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Amyloid β/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H82N14O18SMasse moléculaire :1,211.37 g/molAdrenomedullin (13-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C200H308N58O59S2Masse moléculaire :4,533.17 g/molH-D-Ala-Gln-octadecyl ester·HCl
CAS :<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H51N3O4·HClDegré de pureté :Min. 95%Masse moléculaire :506.16 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H28N2O7SDegré de pureté :Min. 95%Masse moléculaire :548.61 g/molω-Conotoxin MVIIC
CAS :Produit contrôlé<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>Formule :C106H178N40O32S7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,749.26 g/molFmoc-Lys(Nde)-OH
CAS :<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H29N3O8Degré de pureté :Min. 95%Masse moléculaire :583.59 g/molH-Ile-Ile-Ile-OH acetate salt
CAS :<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H35N3O4Degré de pureté :Min. 95%Masse moléculaire :357.49 g/molTyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], Acetylated, Amide, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H110N23O24PMasse moléculaire :1,640.75 g/molZ-Gly-Val-OH
CAS :<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formule :C15H20N2O5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :308.33 g/mol[D-Ala2,Met5]-β-Casomorphin (1-5 , bovine ,amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H42N6O6SMasse moléculaire :626.78 g/molZ-Ile-Val-OH
CAS :<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/molAc-Ser-Asp-Lys-Pro-OH
CAS :<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Formule :C20H33N5O9Degré de pureté :Min. 95%Masse moléculaire :487.5 g/molIsosulfan blue
CAS :<p>Isosulfan blue is a dye that has been used for decades to detect skin cancer in vivo. It is a synthetic compound that binds to the lymphatic system and can be used as an analytical method for detecting cancer. Isosulfan blue is excreted through the urine and can be detected by plasma mass spectrometry, making it a useful tool for assessing toxicity levels in humans. The chemical structure of Isosulfan blue is similar to many other dyes, which makes it difficult to study its toxicity in vivo.</p>Formule :C27H31N2NaO6S2Degré de pureté :Min. 95%Masse moléculaire :566.67 g/molH-D-Arg(Mtr)-OH
CAS :<p>H-D-Arg(Mtr)-OH is a biochemical that is used for the deprotection of prohormones. H-D-Arg(Mtr)-OH has been shown to have an interaction with peptidyl residues, which modulates their activity. H-D-Arg(Mtr)-OH also modulates the allosteric activity of fibrinogen and thrombin receptor. The use of this chemical in solid phase synthesis provides a way to synthesize peptides on a solid support, such as indole rings, amino acids, or nucleotides. The chemical can be used in the hplc system to determine the concentration of small molecules in solution by measuring the peak area.</p>Formule :C16H26N4O5SDegré de pureté :Min. 95%Masse moléculaire :386.47 g/molH-Leu-NHOH·TFA
CAS :<p>H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.</p>Formule :C6H14N2O2·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :260.21 g/molEntacapone
CAS :Produit contrôlé<p>Catechol-O-methyltransferase inhibitor</p>Formule :C14H15N3O5Degré de pureté :Min. 98 Area-%Couleur et forme :Yellow PowderMasse moléculaire :305.29 g/molLeishmania Infantum K39-LinJ Chimeric Antigen, Recombinant
<p>Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Androstenedione antibody
<p>The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.</p>Degré de pureté :Min. 95%Rubella BR2S Antigen
<p>Please enquire for more information about Rubella BR2S Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%GRF (human) acetate salt
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H78N14O19Masse moléculaire :1,179.26 g/molProtein Kinase C Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H100N22O11Masse moléculaire :1,197.5 g/molBoc-Lys(Tfa)-AMC
CAS :<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molGhrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Degré de pureté :Min. 95%Masse moléculaire :4,326.9 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS :<p>H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.</p>Formule :C44H63N11O13Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :954.04 g/molProcollagen Type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH
CAS :<p>Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is a tetrapeptide that is the most abundant component of human skin. It has been shown to have biological properties and can be synthesized in vitro. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH has an absorption maximum at 265 nm, which makes it suitable for use in uv protection creams. It also has a high chemical stability and can be stored for up to two years without degradation. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is used as a substrate in cell culture to study protein synthesis and transcription, or polymerase chain reaction, technique. This peptide also inhibits the activity of proteases such as trypsin and chymotrypsin, making</p>Formule :C23H45N7O9Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :563.65 g/molDABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt
CAS :<p>DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt is a fluorescent substrate for the SARS coronavirus. This compound is an inhibitor of the enzyme that is the target of a drug candidate that inhibits the replication of this virus. Molecular docking studies have shown that DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt binds to 3clpro, which is part of the active site of the enzyme’s catalytic pocket. Inhibition activity was seen in experiments using recombinant proteins, and kinetic analysis showed this inhibitor has a Ki value of 0.7 mM.</p>Formule :C95H141N25O24S2·C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :2,195.47 g/molFeline Calicivirus VP1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Degré de pureté :Min. 95%Feline Herpes Virus 1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Degré de pureté :Min. 95%Big Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide
CAS :<p>Please enquire for more information about N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H35N3O5Degré de pureté :Min. 95%Masse moléculaire :409.52 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H343N61O66SMasse moléculaire :5,002.69 g/molPF-07104091
CAS :<p>PF-07104091 is a peptide that can activate the immune system by binding to an antibody. It is a research tool for use in cell biology, pharmacology, and immunology. PF-07104091 has been shown to inhibit the function of ion channels and receptors. This drug can also be used as a ligand in protein interactions and as an inhibitor of protein interactions.</p>Formule :C19H28N6O4Degré de pureté :Min. 95%Masse moléculaire :404.5 g/molc26 Carnitine-d9
CAS :Produit contrôlé<p>C26 Carnitine-d9 is a stable isotopically labeled form of carnitine, which is a quaternary ammonium compound naturally synthesized from amino acids lysine and methionine in the human body. Its isotopic labeling with deuterium enhances its application in various analytical techniques while retaining the biological properties of natural carnitine. The mode of action involves carnitine's essential role in the transport of long-chain fatty acids into the mitochondrial matrix for β-oxidation, facilitating energy production. C26 Carnitine-d9 is used primarily in metabolic research and diagnostics, particularly in studying fatty acid metabolism, assessing metabolic disorders, and quantifying carnitine levels in biological samples through techniques such as mass spectrometry. Its stable isotopic label allows for precise tracking and quantitation, offering insights into metabolic pathways and biochemical assays crucial for understanding metabolic functions and potential dysfunctions.</p>Formule :C33H56D9NO4Degré de pureté :Min. 95%Masse moléculaire :548.93 g/molNps-Lys(Boc)-OH·DCHA
CAS :Produit contrôlé<p>Please enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C17H25N3O6S·C12H23NDegré de pureté :Min. 95%Masse moléculaire :580.78 g/molOrexin A trifluoroacetate
CAS :<p>Please enquire for more information about Orexin A trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C152H243N47O44S4•(C2HF3O2)xDegré de pureté :Min. 95%CC Chemokine Receptor 3 Fragment II
<p>Catalogue peptide; min. 95% purity</p>Formule :C114H174N24O43S2Masse moléculaire :2,632.91 g/mol[Nle21,Tyr32] Corticotropin Releasing Factor, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C209H343N57O64Masse moléculaire :4,678.29 g/mol[Gln144]-PLP (139-151), Q144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O18Masse moléculaire :1,463.67 g/molGlp-1(7-36), amide acetate
CAS :Produit contrôlé<p>Glp-1(7-36), amide acetate is a peptide that is used as a research tool in cell biology and pharmacology. It has been shown to activate the GLP-1 receptor, which can lead to inhibition of food intake and glucose production by pancreatic beta cells. Glp-1(7-36), amide acetate binds to the GLP-1 receptor and inhibits the binding of agonists such as exendin-4. This binding blocks the activation of G proteins, leading to an increase in intracellular calcium levels. The high purity of this product makes it ideal for use in research settings where trace impurities may interfere with results.</p>Formule :C149H226N40O45·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :3,357.73 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H48N8O14Masse moléculaire :768.78 g/mol[Ser25]-PKC (19-31)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H118N26O17Masse moléculaire :1,559.85 g/molBiotin-(Leu8,D-Trp22,Tyr25)-Somatostatin-28
<p>Catalogue peptide; min. 95% purity</p>Formule :C148H223N43O42S3Masse moléculaire :3,372.88 g/molSomatostatin
CAS :<p>Somatostatin is a polypeptide hormone that is produced by the body to inhibit the release of other hormones in the body. It has also been used to treat diseases such as carcinoid syndrome, intestinal disorders, and diabetes mellitus type I. Somatostatin binds to somatostatin receptors on cells, which leads to inhibition of cell growth and secretion of hormones. Somatostatin has been shown to block basic protein synthesis and energy metabolism in rat liver cells. Its receptor activity is mediated by binding with signal peptide sequences and response elements.</p>Formule :C76H104N18O19S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,637.88 g/molMMP-3
CAS :<p>MMP-3 is a protein that is active in the human body and plays an important role in the breakdown of extracellular matrix. It has been shown to be involved in the disease activity of multiple sclerosis and rheumatoid arthritis. MMP-3 is synthesized as a proenzyme, which contains a signal peptide that directs it to the endoplasmic reticulum (ER). The proenzyme can be activated by two mechanisms: autocatalytic cleavage or by proteolytic cleavage by other enzymes such as serine proteases or metalloproteinases. Calcium pantothenate inhibits MMP-3 activation by autocatalytic cleavage, while nonsteroidal anti-inflammatory drugs inhibit proteolytic cleavage. Transfection experiments have shown that MMP-3 interacts with toll-like receptor 2 (TLR2) and TLR4, which are proteins found on cell surfaces that bind to pathogen</p>Degré de pureté :Min. 95%WX 671
CAS :<p>WX 671 is an oral prodrug that is metabolized to the active compound, WX 672. It has potent anticancer effects and inhibits the growth of cancer cells by blocking the enzyme activity. The biological sample was collected from a fetal bovine and was found to inhibit squamous carcinoma in rats. WX 671 also has clinical relevance as it has been shown to induce apoptosis in tumor cells and inhibit inflammatory bowel disease (IBD). !--</p>Formule :C32H47N5O6SDegré de pureté :Min. 95%Masse moléculaire :629.81 g/mol
![[Tyr12]-Somatostatin-28 (1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00705.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00016.webp&w=3840&q=75)
![[Tyr0]-pTH-Related Protein (1-34) (human, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00858.webp&w=3840&q=75)
![[Tyr0] Gastric Inhibitory Peptide (23-42), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00928.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Des-Tyr1]-β-Endorphin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00420.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00838.webp&w=3840&q=75)
![[Tyr4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00022.webp&w=3840&q=75)
![[Leu144]-PLP (139-151), L144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00494.webp&w=3840&q=75)
![[Lys8,Asn9] Neurotensin LANT-6 (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00542.webp&w=3840&q=75)
![[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00137.webp&w=3840&q=75)
![[Phe2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00173.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![BPDEtide [RKISASEFDRPLR]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00667.webp&w=3840&q=75)
![[Arg8]-a-Neo-Endorphin (1-8)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00867.webp&w=3840&q=75)
![[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00264.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[Arg91, Ala96]-MBP (87-99), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00795.webp&w=3840&q=75)
![[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00527.webp&w=3840&q=75)
![[Tyr63] PTH (63-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00861.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) ,bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00843.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) , bovine, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00842.webp&w=3840&q=75)
![[Ala9,10, Lys11,12] Glycogen Synthase (1-12)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00635.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![Ac-[Nle4,DPhe7] a-MSH (4-10), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00019.webp&w=3840&q=75)
![[Pyr16]-VIP (16-28) (chicken)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00193.webp&w=3840&q=75)
![[D-Asp1]-Amyloid-β-Protein (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00138.webp&w=3840&q=75)
![[Tyr0]-Neurokinin B](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00860.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Pyr11]-Amyloid β-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00356.webp&w=3840&q=75)
![[Tyr8]-Atrial Natriuretic Peptide (5-27), rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00743.webp&w=3840&q=75)
![[Des-Leu9]-Kinetensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00501.webp&w=3840&q=75)
![SIVmac251 (gp140) Fragment (171-190) [Cys]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00518.webp&w=3840&q=75)
![[Tyr43] PTH (43-68) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00915.webp&w=3840&q=75)
![Tyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], Acetylated, Amide, Phosphorylated](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00046.webp&w=3840&q=75)
![[D-Ala2,Met5]-β-Casomorphin (1-5 , bovine ,amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00831.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-676)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00714.webp&w=3840&q=75)
![Ghrelin-[Cys(AF647)] Human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110382.webp&w=3840&q=75)
![N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFT108329.webp&w=3840&q=75)
![[Nle21,Tyr32] Corticotropin Releasing Factor, ovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00739.webp&w=3840&q=75)
![[Gln144]-PLP (139-151), Q144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00496.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
