Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.117 produits)
- Par Biological Target(99.161 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.710 produits)
- Métabolites secondaires(14.222 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Band 3 Protein (547-553) (human)
CAS :<p>Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C41H63N11O11Masse moléculaire :886.02 g/molproFIX28
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H235N43O44Masse moléculaire :3,332.80 g/molCalcitonin, eel
<p>Catalogue peptide; min. 95% purity</p>Formule :C146H241N43O47S2Masse moléculaire :3,414.94 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H87N19O14Masse moléculaire :1,298.48 g/molBrucella Abortus Antigen
<p>Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>BNP (1-21), Pro (Human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H144N28O35Masse moléculaire :2,166.31 g/molMiransertib (ARQ 092) HCl
CAS :<p>Miransertib (ARQ 092) HCl is a selective inhibitor, which is a synthetic small molecule specifically targeting the AKT pathway. It is sourced through specialized chemical synthesis designed to interfere with key signaling pathways implicated in the proliferation and survival of cancer cells. The mode of action involves the inhibition of the serine/threonine kinase AKT, an integral part of the PI3K/AKT/mTOR signaling pathway that is frequently dysregulated in various cancers.</p>Formule :C27H25ClN6Degré de pureté :Min. 95%Masse moléculaire :468.98 g/mol[D-Ala2,Met5]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H41N5O7SMasse moléculaire :627.78 g/molRecombinant Zika Virus NS1 Antigen
<p>Please enquire for more information about Recombinant Zika Virus NS1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>β-Amyloid (10-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C71H99N17O16Masse moléculaire :1,446.68 g/molTACE (ADAM-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H115N24O26Masse moléculaire :1,768.91 g/mol[D-Ala2,DPro4,Tyr5]-β-Casomorphin (1-5), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H42N6O7Masse moléculaire :658.8 g/molC-Type Natriuretic Peptide (1-53) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C251H417N81O71S3Masse moléculaire :5,801.81 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS :<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>Formule :C30H46N10O6•C2HF3O2Degré de pureté :Min. 96 Area-%Couleur et forme :PowderMasse moléculaire :756.77 g/molN-Hippuryl-His-Leu trifluroacetate hydrate
CAS :<p>Hippuryl-His-Leu trifluroacetate hydrate can be used as an artificial substrate for angiotensin-converting enzyme (ACE).</p>Formule :C21H27N5O5(C2F3O2)x(H2O)xDegré de pureté :Min. 95%Masse moléculaire :429.47 g/molH-Arg(NO2)-OBzl p-tosylate salt
CAS :<p>Please enquire for more information about H-Arg(NO2)-OBzl p-tosylate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H19N5O4·C7H8O3SDegré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :481.52 g/molLobeglitazone
CAS :<p>Lobeglitazone is a dipeptidyl peptidase-4 (DPP-4) inhibitor that stimulates glucagon-like peptide-1 receptor (GLP-1R). It is used for the treatment of type 2 diabetes and has been shown to inhibit the proliferation of vascular smooth muscle cells and reduce atherosclerotic lesion size. Lobeglitazone also has an effect on matrix metalloproteinases, which may be related to its ability to inhibit the development of renal fibrosis. Lobeglitazone modulates energy metabolism by increasing insulin sensitivity and reducing insulin levels in blood. This drug also reduces blood pressure and prevents congestive heart failure by lowering blood pressure and improving left ventricular function. The concentration–time curve of lobeglitazone can be monitored with a test that measures serum concentrations every 15 minutes for 24 hours after administration. Lobeglitazone should not be taken by people with metabolic disorders or kidney dysfunction.</p>Degré de pureté :Min. 95%VIP-Lys(Biotin), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C163H263N47O46S2Masse moléculaire :3,681.33 g/mol8S-Cabergoline
CAS :<p>Please enquire for more information about 8S-Cabergoline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H37N5O2Degré de pureté :Min. 95%Masse moléculaire :451.6 g/molHuman ACTH(18-39) trifluoroacetate
CAS :<p>Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C112H165N27O36•(C2HF3O2)xδ (Phospho) Sleep Inducing Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H49N10O18PMasse moléculaire :928.83 g/molWWamide-2
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H65N13O10SMasse moléculaire :992.18 g/molCa-4948
CAS :<p>CA-4948 is a potent small molecule inhibitor, specifically targeting interleukin-1 receptor-associated kinase 4 (IRAK4), which plays a critical role in the Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) signaling pathways. This compound originates from targeted drug discovery efforts aimed at modulating immune-mediated pathways crucial for inflammatory responses.</p>Formule :C24H25N7O5Degré de pureté :Min. 95%Masse moléculaire :491.5 g/molAc-Ser-Asp-Lys-Pro-OH
CAS :<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Formule :C20H33N5O9Degré de pureté :Min. 95%Masse moléculaire :487.5 g/molFolitixorin calcium
CAS :<p>Folitixorin calcium is an inhibitor of peptide interactions. It binds to receptor proteins, preventing the binding of endogenous ligands. Folitixorin calcium can be used as a research tool to study protein interactions, and also as an activator or ligand in the study of receptor proteins. This compound has high purity and is suitable for use in life science research. It is a potent inhibitor of ion channels and antibodies, with no activity against other types of receptors.</p>Formule :C20H23N7O6•CaDegré de pureté :Min. 95%Masse moléculaire :497.52 g/molMOPSO
CAS :<p>MOPSO, also known as 3-(N-Morpholino)-2-hydroxy-1-propanesulfonic acid, a a morpholinic buffer with an optimal pH range of 6.2-7.6 and a pKa of 6.87. It has poor metal ion coordination and can be used in protein work and chromatography.</p>Formule :C7H15NO5SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :225.26 g/molZ-Ile-Val-OH
CAS :<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/mol(Lys4)-Sarafotoxin C acetate salt
CAS :<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>Formule :C105H153N27O36S5Degré de pureté :Min. 95%Masse moléculaire :2,529.83 g/molPRRS-RSAB-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H102N20O23Masse moléculaire :1,675.79 g/molNeurokinin Receptor (393-407), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H87N15O14Masse moléculaire :1,326.53 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H137N25O35Masse moléculaire :2,045.16 g/molN-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide
CAS :<p>Please enquire for more information about N-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C17H21N3ODegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :283.37 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H81N13O14SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,060.27 g/molACTH (6-24), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H175N35O21Masse moléculaire :2,335.79 g/molω-Conotoxin MVIIC
CAS :Produit contrôlé<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>Formule :C106H178N40O32S7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,749.26 g/molFibrinogen β-Chain (24-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H135N25O27Masse moléculaire :1,951.19 g/molAngiotensinogen (1-14), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H122N24O19Masse moléculaire :1,760.05 g/molBrain injury Derived Neurotrophic Peptide(3) BINP
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H101N17O19Masse moléculaire :1,388.58 g/molMBP (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H135N27O26Masse moléculaire :1,879.12 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H28N2O7SDegré de pureté :Min. 95%Masse moléculaire :548.61 g/molβ-Casomorphin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H61N7O11Masse moléculaire :864.02 g/mol[Tyr1]-δ-Sleep Inducing Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H47N9O16Masse moléculaire :825.79 g/molBTM-P1
<p>Catalogue peptide; min. 95% purity</p>Formule :C134H219N33O31Masse moléculaire :2,788.44 g/molBiotin-Obestatin (rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C124H188N36O33Masse moléculaire :2,743.17 g/molAtrial Natriuretic Factor (4-28) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H175N39O35S3Masse moléculaire :2,724.02 g/molAmyloid β-Protein (25-35) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H82N14O13SMasse moléculaire :1,059.31 g/molMKKp2
<p>Catalogue peptide; min. 95% purity</p>Formule :C85H158N31O26S1Masse moléculaire :2,062.41 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H80N12O14Masse moléculaire :1,145.3 g/molMBP (90-106), phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H141N25O22Masse moléculaire :1,913.27 g/molH-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about H-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C88H124N22O15SDegré de pureté :Min. 95%Masse moléculaire :1,762.13 g/mol[Tyr0] Gastric Inhibitory Peptide (23-42), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H182N34O31Masse moléculaire :2,584.92 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formule :C22H36N8O11Masse moléculaire :588.58 g/molCEA Related, QYSWFVNGTF
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H77N13O16Masse moléculaire :1,248.37 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molChorionic Gonadotropin-β(109-119) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H76N16O21SMasse moléculaire :1,269.31 g/molp34cdc2-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H104N16O19Masse moléculaire :1,377.62 g/molGalanin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H237N46O46SMasse moléculaire :3,511.95 g/molF1 Peptide, lobster
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H75N17O11Masse moléculaire :1,066.24 g/molMARCKS PSD-Derived Peptide, PKC Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H122N20O15Masse moléculaire :1,543.93 g/mol[Lys0]-γ-1-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,641.1 g/molLeishmania Infantum K39-LinJ Chimeric Antigen, Recombinant
<p>Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Angiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H126N26O21S2Masse moléculaire :1,864.2 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H147N29O24SMasse moléculaire :2,135.50 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/molVA-β-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H188N36O37SMasse moléculaire :2,831.19 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H67N13O9Masse moléculaire :922.11 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C71H96N16O17S2Masse moléculaire :1,509.78 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H71N13O15Masse moléculaire :1,070.18 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C142H223N35O53S2Masse moléculaire :3,332.68 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H159N29O31Masse moléculaire :2,311.60 g/molA-A-A-Y-G-G-F-L
<p>Catalogue peptide; min. 95% purity</p>Formule :C37H52N8O10Masse moléculaire :768.87 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H67N13O14Masse moléculaire :1,074.19 g/molCarassin (Carrassius Auratus)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molDynorphin A (2-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H117N23O13Masse moléculaire :1,440.81 g/mol[Val5,Asn9]-Angiotensin I
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H86N16O15Masse moléculaire :1,259.44 g/molPrepro-adrenomedullin (153-185), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H224N42O43Masse moléculaire :3,219.56 g/molMyosin Kinase Inhibiting Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H78N18O11Masse moléculaire :987.2 g/molBiotin-Kinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H122N21O29SMasse moléculaire :1,777.92 g/molβ-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C25H47N5O6SMasse moléculaire :545.75 g/molHPV-E7-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H128N24O40Masse moléculaire :2,102.04 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H73N13O10Masse moléculaire :980.20 g/molRosuvastatin
CAS :<p>Rosuvastatin is a synthetic lipid-lowering agent, which is a product of pharmaceutical manufacturing derived from extensive research in cardiovascular pharmacology. It functions as an HMG-CoA reductase inhibitor, effectively blocking the enzyme responsible for cholesterol biosynthesis in the liver. By inhibiting this enzyme, Rosuvastatin reduces the production of cholesterol, especially low-density lipoprotein (LDL) cholesterol, which is known to contribute to atherosclerosis.</p>Formule :C22H28FN3O6SDegré de pureté :Min. 95%Masse moléculaire :481.54 g/molHerpes Virus Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H64N10O14Masse moléculaire :920.46 g/molBiotin-Neuromedin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H87N17O14S2Masse moléculaire :1,358.62 g/mol[Tyr22]-a-CGRP (22-37), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H120N20O25Masse moléculaire :1,785.99 g/molFibronectin Type III Connecting Segment (1-25)
<p>Catalogue peptide; min. 95% purity</p>Formule :C123H195N31O39Masse moléculaire :2,732.04 g/molUremic Pentapeptide (U5-Peptide)
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H48N8O9Masse moléculaire :688.8 g/mol234 CM
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H69N11O14S3Masse moléculaire :1,048.26 g/mol[Asp5,6,Me-Phe8] Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H56N8O11SMasse moléculaire :857.00 g/mol[D-Met2,Pro5] Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H40N6O6SMasse moléculaire :612.75 g/molch-Relaxing Peptide (CARP)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H67N11O7S2Masse moléculaire :830.13 g/mol[Met5, Lys6] a-Neo-Endorphin (1-6)
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H47N7O8SMasse moléculaire :701.85 g/mol[Ile12, Val15] MUC5AC Analog 3
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H112N16O25Masse moléculaire :1,541.73 g/molBicine
CAS :<p>Bicine, also known as N,N-Bis(2-hydroxyethyl)glycine, is a Bis(2-hydroxyethyl) amine buffer with an optimal pH range of 7.6-9.0 and a pKa of 8.26. This buffering agent forms metal complexes and is used in crystallization and enzymatic studies.</p>Formule :C6H13NO4Degré de pureté :Min. 95%Couleur et forme :White SolidMasse moléculaire :163.17 g/molRES-701-1
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H117N23O24Masse moléculaire :2,061.22 g/molβ-Amyloid (1-49)
<p>Catalogue peptide; min. 95% purity</p>Formule :C239H376N62O69SMasse moléculaire :5,253.97 g/molLaminin Penta Peptide, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C26H43N9O7Masse moléculaire :593.7 g/molα-Gliadin (57-73)
<p>Catalogue peptide; min. 95% purity</p>Formule :C93H136N22O27Masse moléculaire :1,994.25 g/molBiotin-Pancreatic Polypeptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C195H301N55O56S3Masse moléculaire :4,407.99 g/molPRRS-PQGAB-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H90N16O19Masse moléculaire :1,423.56 g/molCorticotropin Releasing Factor, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C208H344N60O63S2Masse moléculaire :4,757.44 g/molgp100 (178-187)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N11O14S2Masse moléculaire :1,018.23 g/molMelanotan II, MT-Ⅱ
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H69N15O9Masse moléculaire :1,024.2 g/molPancreatic Polypeptide (31-36) (free acid) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H60N12O9Masse moléculaire :805 g/molβ I probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H116N26O24Masse moléculaire :1,873.99 g/molβ-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H126N24O24Masse moléculaire :1,856.09 g/mol[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H185N31O29SMasse moléculaire :2,510 g/mol4A/4B, Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H100N16O25S2Masse moléculaire :1,593.76 g/molCalcineurin Autoinhibitory Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C124H205N39O39S2Masse moléculaire :2,930.38 g/molα-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H120N18O26SMasse moléculaire :1,745.98 g/molMBP (90-106)
<p>Catalogue peptide; min. 95% purity</p>Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molDynorphin A amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H156N32O22Masse moléculaire :2,146.55 g/molTRH-SH Pro
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H85N21O12S2Masse moléculaire :1,212.46 g/mol2B/3, Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H58N14O12Masse moléculaire :949.09 g/molNES Topoisomerase II α (1017-1028)
<p>Catalogue peptide; min. 95% purity</p>Formule :C73H117N19O19Masse moléculaire :1,564.86 g/molC-Myc peptide epitope
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H86N12O21Masse moléculaire :1,203.32 g/molBak-BH3
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H125N25O24Masse moléculaire :1,724.95 g/molH-GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGA VLVQREKDLPNYNWNSFGLRF-NH2
<p>Kisspeptin P</p>Formule :C257H393N75O78Degré de pureté :Min. 95%Kinase Domain of Insulin Receptor (3)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molSalusin-β
<p>Catalogue peptide; min. 95% purity</p>Formule :C115H176N32O21Masse moléculaire :2,342.89 g/molBiotin-a-CGRP (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C173H281N53O51S2Masse moléculaire :4,015.69 g/molHIV-gp120-41-N-A
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H146N20O20Masse moléculaire :1,936.39 g/molβ-Amyloid/A4 Protein Precusor (APP) (319-335)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H151N31O26S2Masse moléculaire :2,099.48 g/mol[Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Pyr11]-Amyloid β-Protein (11-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molApelin-15 (63-75)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H119N29O16SMasse moléculaire :1,618.94 g/molα-Conotoxin GS
<p>Catalogue peptide; min. 95% purity</p>Formule :C139H232N52O47S7Masse moléculaire :3,608.1 g/molInfluenza A M2 coat protein (22-46)
<p>Catalogue peptide; min. 95% purity</p>Formule :C129H215N31O33Masse moléculaire :2,728.34 g/molCaspase 3 Substrate, chromogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C27H39N7O10Masse moléculaire :621.66 g/molTNF-α(10-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C131H211N43O38Masse moléculaire :2,996.41 g/molOrcokinin
CAS :<p>Orcokinin H-Asn-Phe-Asp-Glu-Ile-Asp-Arg-Ser-Gly-Phe-Gly-Phe is a peptide that was synthesized in the laboratory. It has been shown to have receptor activity and to stimulate locomotor activity in experimental models. Orcokinin H is a member of the family of peptide hormones that are present in mammals. The peptide sequence contains six amino acids, four of which are hydrophobic and two polar, with a single hydroxyl group. These features make this molecule an excellent candidate for use as a model system for studying amyloid protein aggregation and its physiological function.</p>Formule :C67H92N18O23Degré de pureté :Min. 95%Masse moléculaire :1,517.55 g/molEGF Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H100N15O26PMasse moléculaire :1,622.68 g/molSubstance P reversed sequence
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H98N18O13SMasse moléculaire :1,347.66 g/molβ-Amyloid/A4 Protein Precursor (APP) (96-110), analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/molProtein Kinase C Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H100N22O11Masse moléculaire :1,197.5 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H343N61O66SMasse moléculaire :5,002.69 g/molCC Chemokine Receptor 3 Fragment II
<p>Catalogue peptide; min. 95% purity</p>Formule :C114H174N24O43S2Masse moléculaire :2,632.91 g/mol[Nle21,Tyr32] Corticotropin Releasing Factor, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C209H343N57O64Masse moléculaire :4,678.29 g/mol[Gln144]-PLP (139-151), Q144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O18Masse moléculaire :1,463.67 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H48N8O14Masse moléculaire :768.78 g/mol[Ser25]-PKC (19-31)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H118N26O17Masse moléculaire :1,559.85 g/molBiotin-(Leu8,D-Trp22,Tyr25)-Somatostatin-28
<p>Catalogue peptide; min. 95% purity</p>Formule :C148H223N43O42S3Masse moléculaire :3,372.88 g/molAc-VQVD-pNA
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H56N6O13Masse moléculaire :997.08 g/molProtein Kinase C Substrate, Glycogen Synthase (1-8)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H104N18O15Masse moléculaire :1,269.6 g/molBiotin-[Gln1]-Gastrin I (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C107H140N22O34S2Masse moléculaire :2,342.51 g/molH-D-Ala-Gln-octadecyl ester·HCl
CAS :<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H51N3O4·HClDegré de pureté :Min. 95%Masse moléculaire :506.16 g/molSarafotoxin S6d
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H49FN4O14Degré de pureté :Min. 95%Masse moléculaire :876.88 g/molGPC3 (298-306), mouse
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H81N9O18Masse moléculaire :1,108.26 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS :<p>L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.</p>Formule :C30H62N10O6Degré de pureté :Min. 95%Masse moléculaire :658.88 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H59N11O8Masse moléculaire :858.02 g/molH-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH
CAS :<p>Please enquire for more information about H-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C72H97N17O16SDegré de pureté :Min. 95%Masse moléculaire :1,488.71 g/molTyr-Leptin (26-39) (human)
CAS :<p>Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/molµ-Conotoxin GIIIA
CAS :Produit contrôlé<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>Formule :C100H170N38O32S6Degré de pureté :Min. 95%Masse moléculaire :2,609.05 g/molFmoc-Phe-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molDarexaban
CAS :<p>Darexaban is a non-peptidic, small molecule that inhibits the enzyme glucuronide conjugate. It is used to prevent and treat thrombosis and thromboembolism in patients undergoing atrial or abdominal surgery. Darexaban has been shown to be effective in the treatment of heparin-induced thrombocytopenia (HIT) by inhibiting the activation of platelets. The drug also has pharmacokinetic properties that are similar to those of heparin, such as a half-life of 5–7 hours. Darexaban also has anti-inflammatory effects, and can reduce autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis.</p>Degré de pureté :Min. 95%WX 671
CAS :<p>WX 671 is an oral prodrug that is metabolized to the active compound, WX 672. It has potent anticancer effects and inhibits the growth of cancer cells by blocking the enzyme activity. The biological sample was collected from a fetal bovine and was found to inhibit squamous carcinoma in rats. WX 671 also has clinical relevance as it has been shown to induce apoptosis in tumor cells and inhibit inflammatory bowel disease (IBD). !--</p>Formule :C32H47N5O6SDegré de pureté :Min. 95%Masse moléculaire :629.81 g/molδ-Sleep Inducing Peptide trifluoroacetate salt
CAS :<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>Formule :C35H48N10O15Masse moléculaire :848.81 g/mol(Hyp 3,b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9)-Bradykinin trifluoroacetate salt
CAS :<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>Formule :C49H75N15O12SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,098.28 g/molBiotinyl-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C219H336N58O63S2Degré de pureté :Min. 95%Masse moléculaire :4,853.5 g/molBoc-Leu-Gly-Arg-pNA
CAS :<p>a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.</p>Formule :C25H40N8O7Couleur et forme :PowderMasse moléculaire :564.63 g/mol(Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C388H588N106O114S4Degré de pureté :Min. 95%Masse moléculaire :8,689.73 g/mol(Glu20)-Amyloid b-Protein (1-42)
CAS :<p>Please enquire for more information about (Glu20)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C199H309N55O62SDegré de pureté :Min. 95%Masse moléculaire :4,495.98 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C208H308N54O61SDegré de pureté :Min. 95%Masse moléculaire :4,573.06 g/molFITC-b-Ala-Amyloid b-Protein (1-42) ammonium salt
CAS :<p>Please enquire for more information about FITC-b-Ala-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C227H327N57O66S2Degré de pureté :Min. 95%Masse moléculaire :4,974.5 g/mol(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H43N5O8Degré de pureté :Min. 95%Masse moléculaire :637.72 g/mol(Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H69N9O8Degré de pureté :Min. 95%Masse moléculaire :852.07 g/mol(Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C51H82N14O18Degré de pureté :Min. 95%Masse moléculaire :1,179.28 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS :<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formule :C84H119N27O28Degré de pureté :Min. 95%Masse moléculaire :1,955.01 g/molPC Biotin azide
CAS :<p>This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a photocleavable linker. Captured biomolecules can be efficiently released under mild, reagent-free conditions (irradiation with near-UV, low intensity lamp) and the small molecular fragment (100.7 Da) left on the labelled protein following cleavage.</p>Formule :C35H55N9O12SCouleur et forme :PowderMasse moléculaire :825.93 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS :<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Formule :C32H64NO8PDegré de pureté :Min. 95%Masse moléculaire :621.83 g/molH-SIYRYYGL-OH
<p>Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS :<p>Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H32N4O4Degré de pureté :Min. 95%Masse moléculaire :344.45 g/molH-His-Arg-OH trifluroacetate
CAS :<p>Please enquire for more information about H-His-Arg-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H21N7O3•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H44N6O12Masse moléculaire :716.8 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molPKI-tide
CAS :<p>PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.</p>Formule :C85H149N31O24Degré de pureté :Min. 95%Masse moléculaire :1,989.29 g/molL-685458
CAS :<p>Inhibitor of amyloid β-protein precursor γ-secretase</p>Formule :C39H52N4O6Degré de pureté :Min. 95%Masse moléculaire :672.85 g/molγ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H51N11O8Masse moléculaire :705.82 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H121N25O18SMasse moléculaire :1,621 g/mol[Ala5, β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H56N8O9SMasse moléculaire :765 g/molAmyloid β-Protein (31-35)
CAS :<p>Amyloid beta protein is a peptide that is a major component of the amyloid plaques found in the brain of patients with Alzheimer's disease. Amyloid beta protein (Aβ) has been shown to form fibers and fibrils, which are aggregates of polymerized Aβ peptides. These fibrils can be imaged using a fluorescent dye called dansyl. The dansyl-labeled Aβ fibrils have been shown to have a morphology similar to that seen in electron micrographs of amyloid plaques. The quantum yield for luminescence was found to be 0.1% for the Aβ fibrils but only 0.001% for the monomeric form of Aβ peptides (Aβ 1-40). This suggests that the Aβ peptides are undergoing aggregation into amyloid beta protein fibrils before they can emit light as fluorescence or phosphorescence.</p>Formule :C25H47N5O6SDegré de pureté :Min. 95%Masse moléculaire :545.74 g/molPF 05175157
CAS :<p>PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.</p>Formule :C23H27N5O2Degré de pureté :Min. 95%Masse moléculaire :405.49 g/mol[Trp11] Neurotensin (8-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H65N13O7Masse moléculaire :840.05 g/molCaspase 1 Substrate 1 (ICE), chromogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C217H322N58O60SMasse moléculaire :4,767.47 g/molBiotin-Parathyroid Hormone (1-34), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C191H305N57O53S3Masse moléculaire :4,344 g/molDynorphin A (2-12), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H99N19O18S2Masse moléculaire :1,414.67 g/molα-Bag Cell Peptide (1-9)
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H83N15O12Masse moléculaire :1,122.35 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS :<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formule :C23H38N6O5·2HClDegré de pureté :Min. 95%Masse moléculaire :551.51 g/molCJC-1295-no DAC acetate
CAS :<p>CJC-1295-no DAC acetate is a synthetic peptide, which is a modified form of the growth hormone-releasing hormone (GHRH) analog, derived from recombinant sources. Its mode of action involves binding to the growth hormone secretagogue receptor, thereby promoting the release of growth hormone from the anterior pituitary. This mechanism of action facilitates the increase of circulating insulin-like growth factor 1 (IGF-1), enhancing various physiological processes.In scientific research, CJC-1295-no DAC acetate is primarily utilized to study its potential effects on muscle growth, body composition, and overall metabolic function. It is also used to explore its ability to modulate the aging process through growth hormone pathways. Unlike its counterpart with DAC, this variant has a shorter half-life, thus allowing researchers to examine the temporal effects of pulsatile GH release. Furthermore, its applications extend to understanding disorders related to growth hormone deficiencies, contributing valuable insights into therapeutic strategies for such conditions. The peptide serves as an important tool in endocrinology research, providing a platform for studying the complex interactions between hormonal regulation and physiological outcomes.DAC is 'drug affinity complex' and in this peptide works by not having a lysine at the end of the sequence.</p>Formule :C152H252N44O42•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :3,367.9 g/mol
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[D-Ala2,Met5]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00832.webp&w=3840&q=75)
![[D-Ala2,DPro4,Tyr5]-β-Casomorphin (1-5), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00823.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[Tyr1]-δ-Sleep Inducing Peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00855.webp&w=3840&q=75)
![[Tyr0] Gastric Inhibitory Peptide (23-42), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00928.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Lys0]-γ-1-MSH (41-58), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00561.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Tyr22]-a-CGRP (22-37), rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00924.webp&w=3840&q=75)
![[Asp5,6,Me-Phe8] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00320.webp&w=3840&q=75)
![[D-Met2,Pro5] Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00841.webp&w=3840&q=75)
![[Met5, Lys6] a-Neo-Endorphin (1-6)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00875.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00400.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Pyr11]-Amyloid β-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Nle21,Tyr32] Corticotropin Releasing Factor, ovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00739.webp&w=3840&q=75)
![[Gln144]-PLP (139-151), Q144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00496.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![Biotin-[Gln1]-Gastrin I (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00106.webp&w=3840&q=75)
![[Phe7] Dynorphin A (1-7), amide, porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00865.webp&w=3840&q=75)
![[Ala5, β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
