Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.115 produits)
- Par Biological Target(99.074 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.219 produits)
130577 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotin-Phosphorylated MBP (94-102)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H85N20O15SMasse moléculaire :1,273.41 g/mol[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H68N14O10Masse moléculaire :1,109.3 g/molβ-Endorphin (1-27), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C139H217N33O40SMasse moléculaire :3,022.54 g/molβ-Amyloid(1-16), mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H116N26O26Masse moléculaire :1,857.98 g/molAcyl Carrier Protein (65-74) (amide)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H75N13O15Masse moléculaire :1,062.20 g/mol(H-Cys-Gly-OH)2
CAS :<p>Disulfide bond is a covalent chemical bond that links two sulfur atoms to each other. Disulfides are the major form of sulfur-containing proteins, and are important in many biological processes, such as postnatal development, biliary function, hepatitis diagnosis and cancer. Disulfide bonds can be detected using chromatographic methods such as high performance liquid chromatography (HPLC) or gas chromatography (GC). The biosynthesis of disulfides is an essential process in the metabolism of glutathione. Disulfide bonds are formed by the oxidation of two sulfhydryl groups (-SH) in a protein by reactive oxygen species (ROS), which results in the formation of a single disulfide bond between two cysteine residues. This reaction requires glutathione as a cofactor, which catalyzes the formation of -S-S- bridges between two cysteine residues by reducing them to their corresponding thiols (-SH). Glutathione also</p>Formule :C10H18N4O6S2Degré de pureté :Min. 95%Masse moléculaire :354.41 g/molEhrlichia Canis gp19 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS :<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formule :C28H34N4O7SDegré de pureté :Min. 95%Masse moléculaire :570.66 g/mol[Pyr4]-MBP (4-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H100N20O17Masse moléculaire :1,391.61 g/mol[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
<p>Catalogue peptide; min. 95% purity</p>Formule :C13H24N4O3Masse moléculaire :284.36 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H66N10O18Masse moléculaire :1,023.07 g/molBNP-45 ,rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C213H349N71O65S3Masse moléculaire :5,040.79 g/molBAD (103-127), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C137H212N42O39SMasse moléculaire :3,103.54 g/mol[D-Ser14]-Humanin (HN)
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H204N34O32S2Masse moléculaire :2,687.28 g/molMelittin trifluoroacetate
CAS :<p>Melittin is a peptide that is cationic and polycationic. It has been shown to be effective against mutants, such as those resistant to the antibiotic ampicillin. Melittin also has been shown to have a role in the development of vaccines for Brucella and typhimurium. The peptide has been shown to be effective against type species of these bacteria, such as Salmonella typhimurium and Brucella abortus. The mechanism of action of melittin is not fully understood but it may work by binding to the cell membrane, which causes ion leakage and consequently disrupts cellular functions.</p>Formule :C131H228N38O32Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,847.45 g/molLeucokinin IV
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H52N12O12Masse moléculaire :904.9 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H97N21O14SMasse moléculaire :1,512.8 g/mol[D-Phe11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C78H121N21O19Masse moléculaire :1,657 g/molβ-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Formule :C164H242N46O51Masse moléculaire :3,673.94 g/molZ-Ile-Leu-aldehyde
CAS :<p>Please enquire for more information about Z-Ile-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C20H30N2O4Degré de pureté :Min. 95%Masse moléculaire :362.46 g/mol[Tyr11]-Somatostatin
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H102N18O20S2Masse moléculaire :1,651.91 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H67N13O14Masse moléculaire :954.06 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H66N12O9Masse moléculaire :871.08 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H110N24O14Masse moléculaire :1,403.71 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C198H312N62O58Masse moléculaire :4,488.96 g/molKemptide Negative Control
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H61N13O8Masse moléculaire :755.93 g/mol[Tyr1]-Adipokinetic Hormone, locust
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H78N14O15Masse moléculaire :1,211.5 g/molAc-Ser-Asp-Lys-Pro-OH
CAS :<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Formule :C20H33N5O9Degré de pureté :Min. 95%Masse moléculaire :487.5 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molZ-Ile-Val-OH
CAS :<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/molDynorphin A (2-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C90H146N30O21Masse moléculaire :1,984.36 g/molβ-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Formule :C95H152N30O31Masse moléculaire :2,210.45 g/molAc-Adhesin (1025-1044) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/mol[Lys0] g-1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C78H109N23O15SMasse moléculaire :1,640.95 g/mol[Trp11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H122N22O19Masse moléculaire :1,696 g/molCalcium/Calmodulin Dependent Protein Kinase II-g (345-358)
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H107N21O22Masse moléculaire :1,450.63 g/molInfluenza NP (50-57)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H65N11O15Masse moléculaire :952.04 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H108N16O24S5Masse moléculaire :1,718.02 g/molSH2 Domain Ligand (5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H62N7O16PSMasse moléculaire :972.05 g/molHIV-gp120-41-N-A
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H146N20O20Masse moléculaire :1,936.39 g/molMastoparan 7
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H124N18O15Masse moléculaire :1,421.85 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H71N15O11SMasse moléculaire :1,042.24 g/molAc-Hirudin (55-65) (desulfated)
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H92N12O25Masse moléculaire :1,453.53 g/molβ-Amyloid (2-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C190H290N52O55SMasse moléculaire :4,214.81 g/molDT2216
CAS :<p>DT2216 is a small-molecule anticancer compound, which is a product of rational drug design originating from advanced chemical synthesis techniques. The primary mode of action of DT2216 involves selectively targeting and disrupting BCL-XL interactions with pro-apoptotic proteins. By specifically degrading BCL-XL, DT2216 enhances the induction of apoptosis in cancer cells, thereby addressing the challenge of resistance associated with conventional therapies.</p>Formule :C77H96ClF3N10O10S4Degré de pureté :95%NmrMasse moléculaire :1,542.4 g/molBiotin-Glucagon-Like Peptide 1 (7-36), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C159H240N42O47Masse moléculaire :3,524.00 g/molSalusin-β
<p>Catalogue peptide; min. 95% purity</p>Formule :C115H176N32O21Masse moléculaire :2,342.89 g/molDendroaspis Natriuretic Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C180H282N56O56S2Masse moléculaire :4,190.72 g/molH-Ile-Arg-Pro-OH
CAS :<p>Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C17H32N6O4Degré de pureté :Min. 95%Masse moléculaire :384.47 g/molSB-423562
CAS :<p>SB-423562 is a synthetic compound, which is developed as a small molecule inhibitor, produced through chemical synthesis in a laboratory setting. Its mode of action involves selectively interfering with a specific biological pathway by binding to its target protein, thereby inhibiting its activity. This targeted action allows for precise modulation of signaling pathways, which can be pivotal in therapeutic interventions.</p>Formule :C26H32N2O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :436.54 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS :<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C203H311N55O61SDegré de pureté :Min. 95%Masse moléculaire :4,530.04 g/mol(+/-)-Blebbistatin
CAS :<p>Inactive enantiomer of the inhibitor of myosin II-ATPase</p>Formule :C18H16N2O2Degré de pureté :Min. 95%Masse moléculaire :292.33 g/molPKA Inhibitor Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/mol(Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond)
CAS :<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C280H428N66O120S2Degré de pureté :Min. 95%Masse moléculaire :6,702.9 g/molVIP (1-12), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H88N18O22Masse moléculaire :1,425.49 g/molAquaporin-2 (255-271), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H129N25O26Masse moléculaire :1,821.04 g/molBiotin-MBP(94-102)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H84N20O13SMasse moléculaire :1,193.41 g/molADP-Ribosylation Factor 1, ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C85H131N21O21Masse moléculaire :1,783.12 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C205H340N60O53Masse moléculaire :4,493.37 g/molCaspase 2 Substrate, chromogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H43N9O14Masse moléculaire :765.7 g/molFibrinogen β-Chain (24-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H135N25O27Masse moléculaire :1,951.19 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H150N26O31SMasse moléculaire :2,172.46 g/molBradykinin Potentiator B
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H91N15O13Masse moléculaire :1,182.46 g/molCorazonin, American Cockroach, Periplaneta americana
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H86N18O19Masse moléculaire :1,369.49 g/molMirogabalin
CAS :<p>Blocks calcium channels by binding to α₂δ subunits</p>Formule :C12H19NO2Degré de pureté :Min. 95%Masse moléculaire :209.28 g/molGSK3 Peptide Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C470H76N16O16Masse moléculaire :1,121.23 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N13O14S2Masse moléculaire :1,046.24 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H77N13O12SMasse moléculaire :988.22 g/molβ-Amyloid (10-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C71H99N17O16Masse moléculaire :1,446.68 g/molα-casozepine
CAS :<p>CAS No. 117592-45-7 is an ion channel activator that belongs to the group of peptides. It is a high purity product with a purity of 99.5% and has been purified by HPLC. CAS No. 117592-45-7 activates voltage-gated sodium channels in neuronal tissue, which may be due to its ability to bind to the receptor site and activate it, or by binding to the protein and changing its conformation to allow ions through the channel pore. The specificity of this ligand has been shown using antibody inhibition assays on rat erythrocytes and human erythrocytes.</p>Formule :C60H94N14O16Degré de pureté :Min. 95%Masse moléculaire :1,267.5 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>VIP-Lys(Biotin), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C163H263N47O46S2Masse moléculaire :3,681.33 g/molH-9 hydrochloride
CAS :<p>H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.</p>Formule :C11H14ClN3O2SDegré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :287.77 g/molDABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt
CAS :<p>Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C71H91N15O21SDegré de pureté :Min. 95%Masse moléculaire :1,522.64 g/molOzanimod
CAS :<p>Sphingosine 1-phosphate receptor (S1P1R and S1P5R) agonist</p>Formule :C23H24N4O3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :404.46 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H137N25O35Masse moléculaire :2,045.16 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H80N12O14Masse moléculaire :1,145.3 g/molACTH(5-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H50N12O9Masse moléculaire :830.91 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
<p>Catalogue peptide; min. 95% purity</p>Formule :C102H152N26O29Masse moléculaire :2,206.51 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C109H161N25O29S2Masse moléculaire :2,349.78 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H92N15O14S2Masse moléculaire :1,203.52 g/molPrepro VIP (111-122) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H87N13O21Masse moléculaire :1,242.36 g/molα-Casomorphin (1-2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C14H18N2O4Masse moléculaire :278.31 g/molbFGF Inhibitory Peptide II
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H148N30O28SMasse moléculaire :2,178.48 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H178N36O30SMasse moléculaire :2,516.92 g/molErythromycin resistance peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H52N8O6SMasse moléculaire :664.86 g/molAMD 070 Hydrochloride
CAS :<p>an orally active, reversible and selective CXCR4 (CD184, fusin) antagonist</p>Formule :C21H28ClN5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :385.93 g/molAmyloid β-Protein (11-42) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C152H244N40O42SDegré de pureté :Min. 95%Masse moléculaire :3,335.87 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS :<p>Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.</p>Formule :C54H103NO7SDegré de pureté :Min. 95%Masse moléculaire :910.46 g/molH-Cys(Bzl)-Gly-OH trifluoroacetic acid
CAS :<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H16N2O3S•(CF3CO2H)xDegré de pureté :Min. 95%Masse moléculaire :268.33 g/molConantokin T, Marine snail, Conus tullpa
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H175N31O45SMasse moléculaire :2,683.81 g/molACTH (6-24), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H175N35O21Masse moléculaire :2,335.79 g/molBudralazine
CAS :<p>Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.</p>Formule :C14H16N4Degré de pureté :Min. 95%Masse moléculaire :240.3 g/molUrolithin M6
CAS :<p>Urolithin M6 is a metabolite, which is a bioactive compound derived from the metabolism of ellagitannins and ellagic acid found in certain dietary polyphenols. These polyphenols are abundant in fruits such as pomegranates, berries, and nuts. The transformation into urolithins, including Urolithin M6, is facilitated by the gut microbiota, which metabolizes these ellagitannins in the gastrointestinal tract.</p>Formule :C13H8O6Degré de pureté :Min. 95%Masse moléculaire :260.2 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS :<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Formule :C15H23N3O10Degré de pureté :Min. 95%Masse moléculaire :405.36 g/molH-Ile-Ala-OH
CAS :<p>H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.</p>Formule :C9H18N2O3Degré de pureté :Min. 95%Masse moléculaire :202.25 g/molCathelicidin LL 37
CAS :<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Formule :C205H340N60O53Degré de pureté :Min. 95%Masse moléculaire :4,493.27 g/mol15:0 Lyso PC
CAS :<p>15:0 Lyso PC is a lipid with a fatty acid backbone. It is found in the blood and tissue of mammals, such as humans and cows. 15:0 Lyso PC is produced by the liver, where it plays an important role in cholesterol metabolism. This lipid can be used as a diagnostic marker for chronic kidney disease and heart disease. It also has been shown to have a positive correlation with blood pressure levels. Hippuric acid is another potential diagnostic marker for cirrhosis diagnosis and prognosis.</p>Formule :C23H48NO7PDegré de pureté :Min. 95%Masse moléculaire :481.6 g/molNeurokinin Receptor (393-407), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molGSK 2193874
CAS :<p>GSK2193874 is a potent and selective small molecule for the treatment of chronic cough. It inhibits the activation of TRPV4, which is a member of the transient receptor potential cation channel family, in primary cells by pharmacological agents and in vitro by intracellular Ca2+ levels. GSK2193874 has been shown to inhibit acetylcholinesterase activity and to increase cytosolic calcium levels in atrial myocytes. This drug also has effects on congestive heart failure (CHF) patients, such as an increase in left ventricular function and improved pulmonary hemodynamics. GSK2193874 also binds to toll-like receptor 4 (TLR4), which may be a therapeutic target for the treatment of chronic cough.</p>Formule :C37H38BrF3N4ODegré de pureté :Min. 95%Masse moléculaire :691.62 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS :<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C35H40N4O7Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :628.71 g/molH-D-Arg-Arg-Pro-Hyp-Gly-β-(2-thienyl)-Ala-Ser-D-Phe-b-(2-thienyl)-Ala-Arg-OH
CAS :<p>Enalaprilat is a prodrug that is converted to the active drug enalapril in vivo. It is a potent angiotensin-converting enzyme (ACE) inhibitor that prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilatation and reduced blood pressure. Enalaprilat has been shown to be effective in lowering blood pressure in patients with cardiac insufficiency or hypertension. It also has been shown to decrease the production of endogenous bradykinin, which acts on its receptor B2, leading to vasodilatation and reduced blood pressure. The most common side effect of enalaprilat therapy is cutaneous reactions such as erythema, rash, or pruritus.</p>Formule :C56H83N19O13S2Degré de pureté :Min. 95%Masse moléculaire :1,294.51 g/molZ-N-Me-Ser(tBu)-OH·DCHA
CAS :<p>Please enquire for more information about Z-N-Me-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H23NO5·C12H23NDegré de pureté :Min. 95%Masse moléculaire :490.68 g/molAbz-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS :<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C43H62N12O15SDegré de pureté :Min. 95%Masse moléculaire :1,019.09 g/molNeurotensin (8-13), N-Acetyl
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H66N12O9Masse moléculaire :859.05 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS :<p>Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C20H32N4O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :392.49 g/molβ-Amyloid (17-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/molBoc-β-cyclopropyl-Ala-OH·DCHA
CAS :Produit contrôlé<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H19NO4·C12H23NDegré de pureté :Min. 95%Masse moléculaire :410.59 g/molZ-Ala-Ser-OH
CAS :<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>Formule :C14H18N2O6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :310.3 g/mol(Ile76)-TNF-a (70-80) (human)
CAS :<p>Please enquire for more information about (Ile76)-TNF-a (70-80) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C55H91N15O16Degré de pureté :Min. 95%Masse moléculaire :1,218.4 g/molPRRS-RSAB-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H102N20O23Masse moléculaire :1,675.79 g/molH-D-Ile-Asp-OH
CAS :<p>Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H18N2O5Degré de pureté :Min. 95%Masse moléculaire :246.26 g/molAmyloid β-Protein (31-35)
CAS :<p>Amyloid beta protein is a peptide that is a major component of the amyloid plaques found in the brain of patients with Alzheimer's disease. Amyloid beta protein (Aβ) has been shown to form fibers and fibrils, which are aggregates of polymerized Aβ peptides. These fibrils can be imaged using a fluorescent dye called dansyl. The dansyl-labeled Aβ fibrils have been shown to have a morphology similar to that seen in electron micrographs of amyloid plaques. The quantum yield for luminescence was found to be 0.1% for the Aβ fibrils but only 0.001% for the monomeric form of Aβ peptides (Aβ 1-40). This suggests that the Aβ peptides are undergoing aggregation into amyloid beta protein fibrils before they can emit light as fluorescence or phosphorescence.</p>Formule :C25H47N5O6SDegré de pureté :Min. 95%Masse moléculaire :545.74 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H190N32O35SMasse moléculaire :2,625 g/molFertirelin
CAS :<p>Fertirelin is a potent analog of the naturally occurring hormone, follicle-stimulating hormone (FSH). Fertirelin stimulates the release of gonadotropins from the pituitary gland and has been used in the treatment of infertility. This drug also stimulates epidermal growth factor (EGF) production, which may be responsible for its physiological effects on fatty acid metabolism. Fertirelin has been found to stimulate follicular growth in women undergoing fertility treatments with estradiol benzoate. The use of Fertirelin is contraindicated in patients with a history of ovarian cysts or breast cancer. It should not be administered to pregnant women due to its potential for adverse effects on fetal development.</p>Formule :C55H76N16O12Degré de pureté :Min. 95%Masse moléculaire :1,153.29 g/molHSV-gB2 (498-505) acetate
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C41H67N11O13•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :922.06 g/mol[Met5, Lys6,7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H59N9O9SMasse moléculaire :830.02 g/molMARCKS Protein (159-165)
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H72N10O9Masse moléculaire :897.14 g/molMitoridine
CAS :<p>Please enquire for more information about Mitoridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C20H22N2O2Degré de pureté :Min. 95%Masse moléculaire :322.4 g/molTNF-α(71-82), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H91N19O18Masse moléculaire :1,258.41 g/molCa-4948
CAS :<p>CA-4948 is a potent small molecule inhibitor, specifically targeting interleukin-1 receptor-associated kinase 4 (IRAK4), which plays a critical role in the Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) signaling pathways. This compound originates from targeted drug discovery efforts aimed at modulating immune-mediated pathways crucial for inflammatory responses.</p>Formule :C24H25N7O5Degré de pureté :Min. 95%Masse moléculaire :491.5 g/molH-Asp-Ala-OH
CAS :<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Formule :C7H12N2O5Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molH-Ile-NHOH acetate salt
CAS :<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>Formule :C6H14N2O2Degré de pureté :Min. 95%Masse moléculaire :146.19 g/molZ-D-Phe-Phe-Gly-OH
CAS :<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Formule :C28H29N3O6Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :503.55 g/molQX 314
CAS :<p>QX 314 is a synthetic compound that is a potent and selective blocker of voltage-gated Na channels. It has been shown to activate neurons in the central nervous system, inducing locomotor activity, and also to inhibit cardiac contractility. QX 314 binds to the channel pore of voltage-gated Na channels, blocking their activation. The binding site on the channel is not specific for any one type of channel protein α subunit, but it does not bind to other proteins such as the NMDA receptor. This drug has been shown to be effective in treating diabetic neuropathy and bone cancer.</p>Degré de pureté :Min. 95%WWamide-2
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H65N13O10SMasse moléculaire :992.18 g/molMAP Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C101H172N30O32Masse moléculaire :2,318.66 g/molLCZ696
CAS :<p>Lcz696 is an ester prodrug of the active compound crizotinib, which is a selective inhibitor of the enzyme tyrosine kinase. Lcz696 has been shown to be effective in combination therapy for the treatment of patients with metastatic non-small cell lung cancer and those who are resistant to first-line chemotherapy. This drug has also been shown to have beneficial effects on cardiac function and blood pressure. Lcz696 inhibits MMP-9 activity and reduces levels of natriuretic peptides, which may be due to its inhibition of Toll-like receptor 4 (TLR4).</p>Formule :C24H29N5O3•C24H29NO5•(H2O)2•Na3Degré de pureté :Min. 95%Masse moléculaire :1,922.04 g/molZ-Thr(Bzl)-OH·DCHA
CAS :Produit contrôlé<p>Please enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H21NO5·C12H23NDegré de pureté :Min. 95%Masse moléculaire :524.69 g/mol(D-His(Bzl)6)-LHRH (1-7) (free acid)
CAS :<p>Please enquire for more information about (D-His(Bzl)6)-LHRH (1-7) (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C53H62N12O11Degré de pureté :Min. 95%Masse moléculaire :1,043.13 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS :<p>Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.</p>Formule :C33H44N10O7•(HCl)xDegré de pureté :Min. 95%Masse moléculaire :692.77 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molFmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C34H38N2O7Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :586.67 g/molH-Gly-Ala-Asp-OH
CAS :<p>H-Gly-Ala-Asp-OH is a pharmacological treatment for bacterial infection. The drug has been shown to be effective in treating the symptoms of bacterial infections, such as fever and headache, in animal models. H-Gly-Ala-Asp-OH binds to the GABA receptor and inhibits the production of GABA, which is an inhibitory neurotransmitter that regulates neuronal activity. This binding prevents the formation of an inhibitor complex with the enzyme decarboxylase that is required for GABA synthesis and thus inhibits protein synthesis and cell division.</p>Formule :C9H15N3O6Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :261.23 g/molFluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H50FN5O15Degré de pureté :Min. 95%Masse moléculaire :919.9 g/molFelodipine
CAS :<p>L-type calcium channel blocker; anti-hypertensive</p>Formule :C18H19Cl2NO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :384.25 g/molδ (Phospho) Sleep Inducing Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H49N10O18PMasse moléculaire :928.83 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS :<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C34H51N11O7•C2HF3O2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :839.86 g/molC-Type Natriuretic Peptide (1-53) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C251H417N81O71S3Masse moléculaire :5,801.81 g/mol[Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :2,296.6 g/molAc-[Nle4,DPhe7] a-MSH (4-10), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H64N14O10Masse moléculaire :985.12 g/molTACE (ADAM-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H115N24O26Masse moléculaire :1,768.91 g/mol[D-Ala2,Met5]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H41N5O7SMasse moléculaire :627.78 g/molBNP (1-21), Pro (Human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H144N28O35Masse moléculaire :2,166.31 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H87N19O14Masse moléculaire :1,298.48 g/molCalcitonin, eel
<p>Catalogue peptide; min. 95% purity</p>Formule :C146H241N43O47S2Masse moléculaire :3,414.94 g/molproFIX28
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H235N43O44Masse moléculaire :3,332.80 g/molPro-TGF-a
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H87N15O17Masse moléculaire :1,194.4 g/molCanertinib dihydrochloride
CAS :<p>Inhibitor of EGFR, HER2 and HER4 tyrosine kinases</p>Formule :C24H25ClFN5O3·2HClDegré de pureté :Min. 95%Masse moléculaire :558.86Lytic Peptide, Shiva - 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H269N53O39SMasse moléculaire :3,531.27 g/molSALMF amide 2 (S2)
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H82N14O18Masse moléculaire :1,275.4 g/molBiotin-VIP (human, bovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N46O44S2Masse moléculaire :3,552.17 g/mol5-TAMRA-Amyloid β-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about 5-TAMRA-Amyloid beta-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C219H315N55O62SDegré de pureté :Min. 95%Masse moléculaire :4,742.24 g/molAllatostatin I (free acid)
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H94N18O16Masse moléculaire :1,335.5 g/molβ-Endorphin (6-31), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C131H218N34O40Masse moléculaire :2,909.40 g/molGAD65 (78-97)
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H148N26O29S2Masse moléculaire :2,206.53 g/molβ-Amyloid (1-14), mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H95N21O24Masse moléculaire :1,602.65 g/molH-Ile-Pro-OH
CAS :<p>H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.</p>Formule :C11H20N2O3Degré de pureté :Min. 95%Masse moléculaire :228.29 g/molβ-Amyloid (10-35)
<p>Catalogue peptide; min. 95% purity</p>Formule :C133H204N34O37SMasse moléculaire :2,903.38 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molTNF-α (72-82), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N18O16Masse moléculaire :1,171.33 g/molKGF Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C114H174N30O42SMasse moléculaire :2,668.90 g/molGRF (1-29) amide (human) acetate salt
CAS :<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formule :C149H246N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,357.88 g/molFMRF-related peptide, SDPFLRF-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H61N11O10Masse moléculaire :880.02 g/molPep 4A
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H117N21O16Masse moléculaire :1,424.77 g/mol[Gln11]-β-Amyloid (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C194H296N54O57SMasse moléculaire :4,328.91 g/molAlternate Syntide
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H112N18O19Masse moléculaire :1,425.70 g/molCeratotoxin B
<p>Catalogue peptide; min. 95% purity</p>Formule :C135H235N35O32Masse moléculaire :2,860.59 g/molVal-Asp-(Arg8)-Vasopressin
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H79N17O16S2Masse moléculaire :1,298.48 g/molSaposin C18
<p>Catalogue peptide; min. 95% purity</p>Formule :C93H164N24O31Masse moléculaire :2,114.49 g/molgp100 (570-579)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H71N11O17Masse moléculaire :990.09 g/mol19-Epi fk-506
CAS :<p>19-Epi FK-506 is an analog of the immunosuppressive drug FK-506 that has shown promise as an anticancer agent. It has been found to induce apoptosis in cancer cells, particularly in Chinese hamster ovary cells and leukemia cell lines. This compound is a potent inhibitor of protein kinases, which are involved in regulating cell growth and division. 19-Epi FK-506 has been identified as a potential medicinal agent for the treatment of various types of cancer due to its ability to inhibit tumor growth and proliferation. It is excreted in urine and may have therapeutic potential as a cancer inhibitor or in combination with other inhibitors.</p>Formule :C44H69NO12Degré de pureté :Min. 95%Masse moléculaire :804 g/molLuteinizing Hormone-Releasing Hormone, free acid, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H81N17O16SMasse moléculaire :1,304.45 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molCLIP(85-99)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H135N23O19S3Masse moléculaire :1,759.25 g/molAmyloid β-Protein (29-40)
CAS :<p>Please enquire for more information about Amyloid beta-Protein (29-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C49H88N12O13SDegré de pureté :Min. 95%Masse moléculaire :1,085.36 g/mol[Pyr16]-VIP (16-28) (chicken)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H113N17O18SMasse moléculaire :1,476.83 g/molProinsulin C-peptide (55-89), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C153H259N49O52Masse moléculaire :3,616.98 g/mol(Asn670, Sta671,Val672)-Amyloid b/A4 Protein Precursor770 (662-675) ammonium
CAS :<p>Please enquire for more information about (Asn670, Sta671,Val672)-Amyloid b/A4 Protein Precursor770 (662-675) ammonium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C73H118N16O27•(NH3)xDegré de pureté :Min. 95%Masse moléculaire :1,651.81 g/molBiotin-LC-Neurogranin (28-43)
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H159N31O20S2Masse moléculaire :2,139.48 g/molAmyloid β-Protein (1-40) (scrambled) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H295N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,329.81 g/molRG 7388
CAS :<p>Inhibitor of MDM2 E3 ubiquitin-protein ligase and MRP1 transporter</p>Formule :C31H29Cl2F2N3O4Degré de pureté :Min. 95%Couleur et forme :White To Light (Or Pale) Yellow SolidMasse moléculaire :616.48 g/molDok-6 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H113N25O18Masse moléculaire :1,664.90 g/molβ-Casomorphin, bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H55N7O9Masse moléculaire :789.94 g/molBig Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS :<p>Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.</p>Formule :C223H322N56O63S4Degré de pureté :Min. 95%Masse moléculaire :4,923.55 g/molFmoc-Homoarg (Z)2-OH
CAS :<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C38H38N4O8Degré de pureté :Min. 95%Masse moléculaire :678.73 g/molTaranabant
CAS :<p>Inverse agonist of cannabinoid receptor CB1R. Taranabant was studied for its effect on smoking cessation and inducing weight loss. Serious adverse effects associated with this compound prevented further development as a drug in the clinic.</p>Formule :C27H25ClF3N3O2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :515.95 g/molBiotin-MBP Derivatized Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H166N28O25Masse moléculaire :2,252.73 g/molEpitalon acetate
CAS :Produit contrôlé<p>Epitalon acetate is a synthetic analog of melatonin. It has been shown to increase the lifespan of various animals, including mice, rats, and fish. Epitalon acetate also has the ability to regulate spontaneous activity in old age-matched controls by normalizing their physical activity levels. Epitalon acetate also inhibits replication of influenza virus particles in vitro. This compound also has the potential to be used as an optical imaging agent for death and constant markers. Epitalon acetate may have therapeutic applications for humans with leukemia or other cancers.</p>Formule :C16H26N4O11Degré de pureté :Min. 95%Masse moléculaire :450.4 g/molZ-Ile-Pro-OH
CAS :<p>Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.</p>Formule :C19H26N2O5Degré de pureté :Min. 95%Masse moléculaire :362.42 g/molDecorsin, Leech
<p>Catalogue peptide; min. 95% purity</p>Formule :C179H277N55O62S6Masse moléculaire :4,383.87 g/molα-Conotoxin SIA
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H82N18O17S4Masse moléculaire :1,455.7 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H34N2O7SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :590.69 g/molDesmopressin
CAS :Produit contrôlé<p>Desmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.</p>Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molZ-Ile-Trp-OH
CAS :<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C25H29N3O5Degré de pureté :Min. 95%Masse moléculaire :451.51 g/molInsulin B (22-25)
CAS :<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H35N7O5Degré de pureté :Min. 95%Masse moléculaire :525.6 g/mol
![[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00356.webp&w=3840&q=75)
![[Pyr4]-MBP (4-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00186.webp&w=3840&q=75)
![[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00620.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00713.webp&w=3840&q=75)
![[D-Ser14]-Humanin (HN)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00594.webp&w=3840&q=75)
![[D-Phe11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00191.webp&w=3840&q=75)
![[Tyr11]-Somatostatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00218.webp&w=3840&q=75)
![[Tyr1]-Adipokinetic Hormone, locust](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00892.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Trp11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00192.webp&w=3840&q=75)
![[Met5,Arg6,7,Val8,Gly9] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00877.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00427.webp&w=3840&q=75)
![[Ala3,11,18, Nle7] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00286.webp&w=3840&q=75)
![[Met5, Lys6,7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00874.webp&w=3840&q=75)
![[Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50506.webp&w=3840&q=75)
![Ac-[Nle4,DPhe7] a-MSH (4-10), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00019.webp&w=3840&q=75)
![[D-Ala2,Met5]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00832.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Gln11]-β-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Pyr16]-VIP (16-28) (chicken)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00193.webp&w=3840&q=75)
