Produits biochimiques et réactifs

<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.</p>

<p>H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Asp-Gly-OH is a peptide hormone that belongs to the group of hydroxylated aspartic acid. This peptide hormone has been shown to be a lymphocyte transformation factor in vitro and stimulates the production of collagen and other proteins. It has also been shown to have anticarcinogenic effects on bone cancer cells, which may be due to its ability to induce apoptosis. H-Asp-Gly-OH has a neutral pH and forms stable complexes with metal ions, such as copper and zinc, which are important for a variety of biological functions.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Natural prostaglandin; induces uterine contractions; abortifacient</p>

<p>Bicine, also known as N,N-Bis(2-hydroxyethyl)glycine, is a Bis(2-hydroxyethyl) amine buffer with an optimal pH range of 7.6-9.0 and a pKa of 8.26. This buffering agent forms metal complexes and is used in crystallization and enzymatic studies.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>AM 4668 is a biochemical compound, which is derived from synthetic origins with complex organic synthesis processes. Its primary mode of action involves targeted enzymatic inhibition, effectively interacting with specific enzyme active sites to modulate biochemical pathways.</p>

<p>(±)-Carazolol-d7 is a deuterated beta-adrenergic receptor antagonist, often used for pharmacological and biochemical studies. This isotopically labeled compound is a synthetic derivative of carazolol, sourced through precise deuterium exchange techniques designed to ensure high isotopic purity.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Methyltetrazine magnetic beads are uniform polymer-based magnetic spheres of 1 µm diameter. A unique surface means low nonspecific binding in protein-based systems, and superior handling without the use of surfactant. These high-binding beads are suitable for use across a range of research and diagnostic applications, whether you’re working at laboratory scale or have the more stringent requirements of high throughput applications.<br>Activation level: 20-35 nmol methyltetrazine groups per mg<br>Bead diameter: 0.8-1 µmThe magnetic beads are not stable in organic solvents.  Work in aq. solutions at a pH range of 4-9.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>KT-474 is an oral small molecule protein degrader, which is derived from targeted protein degradation technology. This compound functions as an investigational agent specifically designed to degrade IRAK4, a key kinase involved in the signaling pathways of pro-inflammatory cytokines such as IL-1 and IL-18, which are crucial in the regulation of innate and adaptive immunity. The mode of action is based on hijacking the cell's ubiquitin-proteasome system to selectively bind to and degrade IRAK4, thereby reducing inflammation at the molecular level.</p>

<p>Policosanol is a natural substance that is obtained from sugar cane. It is a mixture of various alcohols, including octacosanol, hexacosanol, heptacosanol, and octacosanol. Policosanol has been studied for its potential to treat high cholesterol levels in the blood by reducing low-density lipoprotein-cholesterol (LDL-C) and triglycerides. Animal studies have shown that policosanol can lower LDL-C and reduce the risk of heart disease by preventing the formation of plaque in the arteries. Policosanol also reduces the risk of heart attack and stroke by lowering blood pressure and decreasing platelet aggregation. It may also be used as an antioxidant or anti-inflammatory agent.</p>

<p>Disulfide bond is a covalent chemical bond that links two sulfur atoms to each other. Disulfides are the major form of sulfur-containing proteins, and are important in many biological processes, such as postnatal development, biliary function, hepatitis diagnosis and cancer. Disulfide bonds can be detected using chromatographic methods such as high performance liquid chromatography (HPLC) or gas chromatography (GC). The biosynthesis of disulfides is an essential process in the metabolism of glutathione. Disulfide bonds are formed by the oxidation of two sulfhydryl groups (-SH) in a protein by reactive oxygen species (ROS), which results in the formation of a single disulfide bond between two cysteine residues. This reaction requires glutathione as a cofactor, which catalyzes the formation of -S-S- bridges between two cysteine residues by reducing them to their corresponding thiols (-SH). Glutathione also</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct is a catalyst that can be used for the reduction of various functional groups. It is typically used to synthesize aziridines from amines and diazo compounds, or from halides and organometallic reagents. 1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct has been shown to inhibit the production of sulfoxides by sulfide-reducing bacteria such as Desulfovibrio desulfuricans and Desulfobulbus propionicus.</p>

<p>HC-067047 is an experimental drug that has been shown to decrease the intracellular Ca2+ concentration in various cell types, including neurons. This agent also inhibits the influx of Ca2+ ions through voltage-gated channels and blocks the release of Ca2+ from intracellular stores. HC-067047 is being investigated for chronic cough as it has been shown to reduce this symptom in a guinea pig model of asthma. In vitro studies have shown that HC-067047 is not active against protozoa or bacteria but does inhibit the growth of tumor cells. The mechanism of action for HC-067047 is not fully elucidated, but it may act by inhibiting ion transport proteins such as TRPV4, Toll-like receptor, or Ryanodine receptor. HC-067047 has also been found to increase MMP9 activity and inhibit production of cytokines such as IL-6 and TNFα.</p>

<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>PIPES, also known as, Piperazine-N,N-bis(2-ethanesulfonic acid) is a piperazinic buffer with an optimal pH range of 6.1-7.5 and a pKa of 6.76. This buffering agent can be used in culture media, crystallization, electrophoresis, and chromatography and is non-coordinating.</p>

<p>Please enquire for more information about N-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Trt-Glu(OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Hypoglycemic agent</p>

<p>H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TFA salt. Catalogue peptide; min. 95% purity</p>

<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Thr-Phe-OH is a fatty acid which is the substrate for tumor cells. It has been shown to be effective against various types of cancer, including metastatic colorectal cancer and malignant brain tumors. H-Thr-Phe-OH binds to tumor cells through fatty acid binding domains on the cell surface, which leads to tumor cell death. This drug also stimulates an increase in the production of natural killer cells, a type of white blood cell that attacks virus infected cells and tumor cells. The activity index for this drug was measured at 3.1 in mice with experimental bowel disease and found to be effective at inhibiting the progression of bowel disease. H-Thr-Phe-OH has also been shown to be effective at treating inflammatory bowel disease in mouse models.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>JNJ 303 is a drug that belongs to the class of molecular models. It is used in model studies with anesthetized animals and as a molecular modelling agent for cardiac arrhythmias. JNJ 303 has been shown to have proarrhythmic effects on the heart and to cause ectopic expression of Kv1.5 potassium channels in the heart, leading to increased cardiac excitability. This drug has also been shown to have electrophysiological properties, such as prolonging action potential duration and increasing refractory periods. The subunit interactions between JNJ 303 and Kv1.5 channels are validated by computational simulations.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>

<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>

<p>PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Estradiol Conjugate for use in immunoassays</p>

<p>PF-07104091 is a peptide that can activate the immune system by binding to an antibody. It is a research tool for use in cell biology, pharmacology, and immunology. PF-07104091 has been shown to inhibit the function of ion channels and receptors. This drug can also be used as a ligand in protein interactions and as an inhibitor of protein interactions.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>

<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>

<p>nAChRs nicotinic receptor antagonist; neuromuscular-blocking agent</p>

<p>Calcium Dobesilate Hydrate is a pharmaceutical compound, which is a synthesized chemical derived from dobesilic acid. It functions primarily as a vasoprotective agent, reducing vascular permeability and stabilizing capillary walls by inhibiting platelet aggregation and the release of free radicals. This results in decreased capillary fragility and improved blood flow in microcirculatory systems.</p>

<p>CIN16645 is a peptide inhibitor of protein interactions. It has been shown to bind to the receptor and inhibit the activation of ion channels, which are proteins that form pores in cell membranes to allow ions to pass through. CIN16645 is a ligand for the receptor and can be used as a research tool for studying ion channels. The purity of this product is high, with no detectable impurities. This product is intended for use in life sciences research applications, such as antibody production and cell biology research.</p>