Produits biochimiques et réactifs

<p>PGK1 antibody was raised using the N terminal of PGK1 corresponding to a region with amino acids PEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFR</p>

<p>CD44 antibody was raised in mouse using chicken CD44 as the immunogen.</p>

<p>ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen</p>

<p>KIR3DL1 antibody was raised in Rabbit using Human KIR3DL1 as the immunogen</p>

<p>FBF1 antibody was raised in Rabbit using Human FBF1 as the immunogen</p>

<p>Rat monoclonal TER119 antibody (PE)</p>

<p>FEZF1 antibody was raised in rabbit using the C terminal of FEZF1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D14 antibody, catalog no. 70R-4318</p>

<p>RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY</p>

<p>Purified recombinant EXOSC1 protein (His tag)</p>

<p>NEGR1 antibody was raised in rabbit using the N terminal of NEGR1 as the immunogen</p>

<p>Rabbit polyclonal RAB31 antibody</p>

<p>Rabbit polyclonal OR8G1 antibody</p>

<p>Affinity purified Rabbit polyclonal Cyclin T2 antibody</p>

<p>FAM83E antibody was raised using the middle region of FAM83E corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM</p>

Phenytoin (USP grade powder) chemical reference substance

<p>The SAMHD1 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to SAMHD1, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and analyzing SAMHD1 expression in different tissues and cell types.</p>

<p>The Cathepsin G antibody is a highly effective and versatile basic protein that plays a crucial role in the immune system. This antibody specifically targets and neutralizes the activity of Cathepsin G, an enzyme involved in various physiological processes. By inhibiting Cathepsin G, this antibody helps regulate immune responses and maintain overall health.</p>

<p>PPP2R5D antibody was raised using the middle region of PPP2R5D corresponding to a region with amino acids ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA</p>

<p>The TIMP2 antibody is a monoclonal antibody that specifically targets and binds to TIMP2 (Tissue Inhibitor of Metalloproteinase 2). This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Rabbit polyclonal STAT3 antibody (Ser727)</p>

<p>Mouse monoclonal POLR2J2 antibody</p>

<p>CRNN antibody was raised in Rabbit using Human CRNN as the immunogen</p>

<p>CXADR antibody was raised in Rabbit using Human CXADR as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AP1G1 antibody, catalog no. 70R-3825</p>

<p>LSM1 antibody was raised in Rabbit using Human LSM1 as the immunogen</p>

<p>Rabbit polyclonal CEBPG antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PYGO2 antibody, catalog no. 70R-9075</p>

<p>Rabbit polyclonal PMPCB antibody</p>

<p>Purified recombinant Human ACYP1 protein</p>

<p>Akt, also known as Protein Kinase B (PKB), is a critical signaling protein in cells that regulates essential processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth, which is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. This allows Akt to influence downstream processes, promoting cell survival by inhibiting apoptosis, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism—especially important for insulin response.Akt plays a significant role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>C6ORF154 antibody was raised using the middle region of C6Orf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes.

<p>GM2A antibody was raised using the N terminal of GM2A corresponding to a region with amino acids MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHO antibody, catalog no. 70R-9928</p>

<p>Purified Polyclonal NDUFA4 antibody</p>

<p>Rabbit polyclonal KPB1/2 antibody</p>

<p>DRAM antibody was raised in rabbit using the N terminal of DRAM as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYNC1I2 antibody, catalog no. 70R-4497</p>

<p>The GCG antibody is a monoclonal antibody that specifically targets the CD20 protein, a glycoprotein found on the surface of certain cells. This antibody-drug complex is designed to bind to the CD20 antigen, leading to the inhibition of cell growth and proliferation. The GCG antibody has shown promising results in the treatment of various diseases, including certain types of cancer and autoimmune disorders. It works by selectively targeting and destroying CD20-positive cells while sparing healthy cells. In addition to its therapeutic applications, this monoclonal antibody can also be used as a research tool for studying the role of CD20 in various biological processes. Its high specificity and affinity make it an invaluable tool for scientists and researchers working in the field of immunology.</p>

<p>Purified recombinant FCER1A protein (His tag)</p>

<p>KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KPTN antibody, catalog no. 70R-3023</p>

<p>Rabbit polyclonal PPFIA3 antibody</p>

<p>The WIF1 protein is a monoclonal antibody that belongs to the group of conjugated proteins. It has been shown to neutralize oncostatin, a growth hormone receptor inhibitory factor. This monoclonal antibody can specifically bind to autoantibodies and activate an antigen-antibody reaction. The WIF1 protein exhibits excellent photostability and can be used in various applications due to its emission properties. Its unique composition includes thiocyanate, which enhances its stability and efficacy.</p>

<p>FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF</p>

<p>SUZ12 antibody was raised in rabbit using the C terminal of SUZ12 as the immunogen</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>TCF23 antibody was raised in rabbit using the C terminal of TCF23 as the immunogen</p>

<p>The AQP1 antibody is a highly specialized monoclonal antibody that targets the aquaporin 1 protein. Aquaporin 1 is a transmembrane protein that facilitates the transport of water across cell membranes. This antibody has been extensively studied and shown to have a high affinity for aquaporin 1, making it an excellent tool for research in various fields such as life sciences.</p>