Produits biochimiques et réactifs

<p>Purified Rabbit polyclonal PNMA2 antibody</p>

<p>The Influenza B antibody is a monoclonal antibody that has been developed to specifically target and neutralize the Influenza B virus. This antibody is a powerful tool in the fight against influenza, as it can recognize and bind to specific proteins on the surface of the virus, preventing it from infecting host cells.</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS</p>

<p>Recombinant Human PIH1D2 protein</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>The STMN1 antibody is a monoclonal antibody that targets the growth factor Stathmin 1 (STMN1). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Growth Hormone antibody was raised in mouse using recombinant human growth hormone (27-217aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>Esrp2 antibody was raised in rabbit using the C terminal of Esrp2 as the immunogen</p>

<p>Hamster lymphocyte antibody (FITC) was raised in rabbit using RBC-free hamster thymus and spleen cells as the immunogen.</p>

<p>Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI</p>

<p>The Cytokeratin 8 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and inhibits the growth of endothelial cells, which play a crucial role in angiogenesis and tumor development. By neutralizing the activity of endothelial growth factors, this antibody has shown promising results in inhibiting tumor growth and metastasis.</p>

<p>IFN beta antibody was raised in rabbit using rat interferon beta as the immunogen.</p>

<p>The CEA antibody is a highly specialized monoclonal antibody that targets carcinoembryonic antigen (CEA). It is widely used in the field of life sciences for various applications. This antibody specifically recognizes and binds to CEA, a glycosylated protein that is involved in cell adhesion and plays a role in insulin signaling.</p>

<p>Rabbit polyclonal RTKN2 antibody</p>

<p>Rabbit polyclonal ELMOD2 antibody</p>

<p>Rhodamine B hydrazide is a fluorescent chemical probe, which is synthetically derived from Rhodamine B, a xanthene dye. This compound functions primarily as a reactive oxygen species (ROS) detector, facilitated by its unique molecular structure that allows it to selectively respond to oxidative environments.</p>

<p>Rabbit polyclonal TRERF1 antibody</p>

<p>Rabbit polyclonal MYD1 antibody</p>

<p>Purified Rabbit polyclonal PKA antibody (Thr197)</p>

<p>The LLO antibody is a high-quality monoclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize superoxide, a highly reactive oxygen species that can cause damage to cells and tissues. This antibody has a high specific activity and exhibits low density, making it an ideal choice for various applications such as enzyme-linked immunosorbent assays (ELISA), Western blotting, and immunohistochemistry.</p>

<p>The HIP1 antibody is a highly specialized reagent used in life sciences research. It is a polyclonal antibody that specifically targets hematopoietic and gastrointestinal stromal proteins. This antibody has the ability to bind to DNA double-strand breaks, making it an invaluable tool for studying DNA repair mechanisms. The HIP1 antibody can be used in various applications, including immunohistochemical staining and protein interaction studies. Researchers can use this antibody as a test compound to evaluate the efficacy of potential inhibitors or affinity ligands. With its high specificity and versatility, the HIP1 antibody is an essential tool for scientists working in the field of molecular biology and genetics.</p>

Hemoglobin antibody was raised in mouse using human hemoglobin as the immunogen.

<p>Purified Rabbit polyclonal OR1B1 antibody</p>

<p>MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM</p>

<p>CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC</p>

<p>Proteasome 20S antibody was raised in rabbit using a Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2 as the immunogen.</p>

<p>SLC25A28 antibody was raised using the middle region of SLC25A28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH</p>

<p>Rabbit polyclonal Ring1A antibody</p>

Rabbit polyclonal RECQL5 antibody

<p>TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT</p>

<p>Akt, also known as Protein Kinase B (PKB), is an essential cellular protein that governs vital processes such as cell growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones like insulin. Upon activation, Akt translocates to the cell membrane, where it undergoes full activation via phosphorylation by kinases like PDK1. This activation allows Akt to prevent apoptosis, promote cell growth via pathways like mTOR, and boost glucose metabolism, crucial for insulin responsiveness. Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>Mouse monoclonal PYCR2 antibody</p>

<p>Purified Polyclonal NT5C1B antibody</p>

<p>Rat monoclonal CD16/32 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal UBL3 antibody</p>

<p>Purified recombinant JDP2 protein (His tag)</p>

<p>YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL</p>

<p>GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF</p>

<p>Purified Rabbit polyclonal PIPOX antibody</p>

<p>The ABL1 antibody is a monoclonal antibody that specifically targets the growth factor receptor ABL1. This biomolecule plays a crucial role in cell growth, division, and survival. The ABL1 antibody is designed to bind to the activated form of ABL1, neutralizing its function and preventing further downstream signaling.</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>Rabbit polyclonal PIAS3 antibody</p>

<p>Mouse monoclonal MAGEB18 antibody</p>

<p>Mouse monoclonal TAB1 antibody (N-terminus)</p>

<p>Rabbit polyclonal IQCB1 antibody</p>

<p>Rabbit polyclonal SCN5A antibody</p>

<p>Rabbit Polyclonal OR5P2 antibody</p>

<p>GAL3ST3 antibody was raised using the C terminal of GAL3ST3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP</p>

Rabbit polyclonal RNF133 antibody