Produits biochimiques et réactifs

<p>ALDH3A2 antibody was raised using the middle region of ALDH3A2 corresponding to a region with amino acids DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR</p>

<p>IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC</p>

LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPA1 antibody, catalog no. 70R-5546</p>

<p>Mouse monoclonal ELK3 antibody</p>

<p>Purified recombinant UMPS protein</p>

<p>Rat macrophage antibody (FITC) was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Purified recombinant RPS12 protein (His tag)</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>IL18R1 antibody was raised using the N terminal of IL18R1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE</p>

<p>Rabbit polyclonal SLPI antibody (HRP)</p>

<p>The CEA antibody is a monoclonal antibody that specifically targets e-cadherin, a glycoprotein involved in cell adhesion. This antibody is designed to recognize and bind to e-cadherin, inhibiting its activity and preventing cell-cell interactions. The CEA antibody is commonly used in life sciences research and biochemical studies to investigate the role of e-cadherin in various cellular processes.</p>

<p>CALML4 antibody was raised in Rabbit using Human CALML4 as the immunogen</p>

<p>Rabbit polyclonal STOML3 antibody</p>

<p>The Trazodone antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is an antifibrotic agent that specifically targets glycoproteins involved in fibrosis. This antibody recognizes and binds to specific glycosylation sites on target proteins, inhibiting their phosphatase activity and preventing the formation of amyloid plaques. The Trazodone antibody has been shown to be effective in reducing fibrosis in various animal models and has potential therapeutic applications in the treatment of fibrotic diseases. Its unique specificity and high affinity make it a valuable tool for researchers studying fibrosis and related disorders.</p>

<p>Purified Rabbit polyclonal TUBGCP3 antibody</p>

<p>Recombinant Human CLEC4E protein (His tag)</p>

<p>BCAP29 antibody was raised in Rabbit using Human BCAP29 as the immunogen</p>

<p>The AFP antibody is a specific antibody that targets alpha-fetoprotein (AFP), a protein that is often associated with certain types of cancer. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in cancer research. The AFP antibody works by binding to AFP and inhibiting its function, which can help prevent the growth and spread of cancer cells. It has been used in various research applications, including studies on the role of AFP in tumor development and progression. The AFP antibody is highly specific and can be used for detection purposes, such as in immunohistochemistry or ELISA assays. Its use in combination with other antibodies or techniques, such as saponin permeabilization or nuclear staining, allows for more comprehensive analysis of cellular processes involving AFP. Researchers and scientists rely on the AFP antibody to gain valuable insights into the mechanisms underlying cancer development and to develop potential therapeutic strategies targeting this protein.</p>

<p>The PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA). It is commonly used in medical research and diagnostics for the detection and quantification of PSA levels. This antibody has high specificity and sensitivity, making it a valuable tool in the diagnosis and monitoring of prostate cancer. The PSA antibody works by binding to PSA molecules, preventing their interaction with other proteins and inhibiting their activity. It can be used in various applications such as immunoassays, immunohistochemistry, and western blotting. The PSA antibody is nephrotoxicity-free and does not interfere with other cellular processes or pathways. With its exceptional performance and reliability, this antibody is an essential component in the field of life sciences and offers great potential for further advancements in prostate cancer research.</p>

<p>IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP</p>

<p>Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK</p>

<p>Rabbit polyclonal QRSL1 antibody</p>

<p>The USP10 antibody is a growth factor that belongs to the class of antibodies. It is specifically designed to target and neutralize dinitrophenyl (DNP) antigens. This monoclonal antibody has been extensively tested and validated for its high specificity and affinity towards DNP antigens. It can be used in various applications, including immunoassays, Western blotting, ELISA, and flow cytometry.</p>

SSB protein is a cytotoxic monoclonal antibody that neutralizes the activity of the SSB protein in human serum. This protein is involved in various biological processes, including DNA replication and repair. In Life Sciences, SSB protein plays a crucial role in the binding and stabilization of single-stranded DNA during DNA synthesis. Additionally, it interacts with other proteins such as calmodulin and a1 protein to regulate cellular functions.

<p>The MCL1 antibody is a highly specialized tool used in various assays and research applications. It is designed to specifically target and inhibit the activity of MCL1, a protein involved in cell survival and apoptosis regulation. This monoclonal antibody works by binding to MCL1 and neutralizing its function, allowing researchers to investigate its role in different cellular processes.</p>

<p>The SERP1 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor epidermal growth factor (EGF). This antibody is derived from histidine-rich polyclonal antibodies, making it highly effective in inhibiting the activity of EGF. It specifically binds to EGF and prevents its interaction with cell surface receptors, thus blocking downstream signaling pathways involved in cell proliferation and survival.</p>

<p>KRT2A antibody was raised using the middle region of Krt2A corresponding to a region with amino acids EVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELN</p>

<p>The TAK1 antibody is a highly specialized growth factor protein used in Life Sciences research. It acts as an anti-MERTK antibody, targeting the MERTK receptor involved in cell signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. It specifically binds to transferrin and stimulates the growth of colonies of cells in vitro. The TAK1 antibody also plays a crucial role in regulating actin filaments and colony-stimulating factors. It is available as both polyclonal and monoclonal antibodies, providing researchers with versatile options for their experiments. Additionally, this antibody has shown potential effects on adipose tissue and steroid metabolism, as well as its interaction with transforming growth factor-beta 1 (TGF-β1).</p>

<p>The HER2 antibody is a monoclonal antibody that specifically targets the HER2 protein, which is overexpressed in certain types of cancer cells. This antibody inhibits the growth and proliferation of cancer cells by blocking the interaction between HER2 and other growth factors, such as epidermal growth factor and hepatocyte growth factor. Additionally, the HER2 antibody has been shown to have anti-angiogenic properties by inhibiting the production of vascular endothelial growth factor (VEGF) and VEGF-C, which are essential for the formation of new blood vessels. This antibody can be used as a targeted therapy for patients with HER2-positive cancers, such as breast and gastric cancer.</p>

<p>Recombinant Human GTF2H5 protein</p>

<p>CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA</p>

<p>Synaptobrevin 2 antibody was raised in mouse using recombinant human Synaptobrevin 2 (1-89aa) purified from E. coli as the immunogen.</p>

<p>BIN2 antibody was raised in Rabbit using Human BIN2 as the immunogen</p>

<p>RASL10A antibody was raised using the N terminal of RASL10A corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ</p>

<p>PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS</p>

<p>B4GALNT1 antibody was raised using the N terminal of B4GALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG</p>

<p>Rabbit polyclonal ATXN7L1 antibody</p>

<p>The IGJ antibody is a specific antibody that targets the immunoglobulin J (IGJ) protein. This protein is involved in the production and secretion of antibodies in the body. The IGJ antibody has been extensively studied and validated using various techniques such as transcription-polymerase chain reaction (PCR), enzyme labeling, particle chemiluminescence, and more. It has been shown to have high affinity and specificity for the IGJ protein, making it an ideal tool for research and diagnostic applications. Additionally, this monoclonal antibody has neutralizing properties, allowing it to inhibit the activity of the IGJ protein. With its low density and ability to detect IGJ in human serum at low plasma levels, this antibody is a valuable asset for any laboratory or research facility working with immunoglobulins.</p>

<p>Purified Rabbit polyclonal OR5W2 antibody</p>

<p>Mouse monoclonal C5a desArg antibody</p>

<p>FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.</p>

Mouse monoclonal Bt Cry1F antibody

<p>Armenian Hamster monoclonal CD80 antibody (biotin)</p>

<p>Rabbit polyclonal BMP3 antibody</p>

<p>Rabbit polyclonal REC8 antibody</p>

<p>The PRDX4 antibody is a highly specific monoclonal antibody that targets and binds to peroxiredoxin-4 (PRDX4), an important antioxidant enzyme. This antibody is widely used in life sciences research to study the role of PRDX4 in various cellular processes.</p>

<p>UBN1 antibody was raised in mouse using recombinant Ubinuclein 1 (Ubn1)</p>

<p>Rabbit Polyclonal SOX9 antibody (Ser181)</p>