Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Mouse Thymocyte antibody
<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>Degré de pureté :Min. 95%EVI2A antibody
<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>Degré de pureté :Min. 95%GSR antibody
<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>Degré de pureté :Min. 95%CDKN1B antibody
<p>The CDKN1B antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase inhibitor 1B (CDKN1B). CDKN1B is a protein that plays a crucial role in cell cycle regulation and acts as a tumor suppressor. This antibody binds to CDKN1B and inhibits its function, leading to uncontrolled cell growth and proliferation.</p>GFAP antibody
<p>The GFAP antibody is a highly specialized polyclonal antibody that is used in Life Sciences research. It is designed to target and neutralize autoantibodies against glial fibrillary acidic protein (GFAP), which is an important marker for astrocytes in the central nervous system. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>Degré de pureté :Min. 95%TRIM45 antibody
<p>TRIM45 antibody was raised using the middle region of TRIM45 corresponding to a region with amino acids EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP</p>VSIG1 antibody
<p>VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN</p>Degré de pureté :Min. 95%p53 antibody
<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody is commonly used in research laboratories and medical institutions for various applications.</p>KEAP1 antibody
<p>The KEAP1 antibody is a highly specialized monoclonal antibody that targets KEAP1, a protein involved in the regulation of cellular responses to oxidative stress. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and neurodegenerative disorders.</p>RBM14 antibody
<p>RBM14 antibody was raised in rabbit using the N terminal of RBM14 as the immunogen</p>Degré de pureté :Min. 95%ORC6L antibody
<p>ORC6L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE</p>Degré de pureté :Min. 95%EphA2 antibody
<p>EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.</p>STEAP2 antibody
<p>The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.</p>AFP antibody
<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a protein that is produced during fetal development and in certain cancers. This antibody has been shown to inhibit the growth of endothelial cells, which play a crucial role in tumor angiogenesis. Additionally, the AFP antibody has been used in research studies to investigate the potential therapeutic effects of targeting keratinocyte growth factor (KGF) signaling pathways. It has also demonstrated neutralizing activity against other growth factors, such as VEGF and circumsporozoite protein. The AFP antibody may have potential applications in the field of life sciences and could be a valuable tool for researchers studying cancer biology and developing targeted therapies.</p>PCDH8 antibody
<p>PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG</p>Degré de pureté :Min. 95%RGS8 antibody
<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>Degré de pureté :Min. 95%GPT2 protein (His tag)
<p>Purified recombinant Human GPT2 protein (His tag)</p>Degré de pureté :Min. 95%IL1b antibody (biotin)
<p>IL1b antibody (biotin) was raised in goat using E. Coli derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>LPAR1 antibody
<p>The LPAR1 antibody is a monoclonal antibody that targets the Lysophosphatidic Acid Receptor 1 (LPAR1). It plays a crucial role in various cellular processes, including cell growth, migration, and survival. This antibody has been extensively studied in the field of life sciences and has shown promising results.</p>Thyroglobulin protein
<p>Human Thyroglobulin (Tg) is a large glycoprotein produced by the thyroid gland, serving as a precursor for the production of thyroid hormones, thyroxine (T₄) and triiodothyronine (T₃). It is synthesized and stored in the thyroid follicular cells, where it plays a crucial role in hormone synthesis by binding iodine and undergoing enzymatic processing to release active thyroid hormones into the bloodstream.</p>Degré de pureté :>98% Pure By Sds PagePKD2 antibody (Ser876)
<p>Human phosphopeptide (Ser876) immunogen; rabbit polyclonal PKD2 antibody (Ser876)</p>Mouse anti Rat IgG (Fc) (HRP)
<p>Rat IgG antibody was raised in mouse using Rat IgG Fc region as the immunogen.</p>Degré de pureté :Min. 95%POR antibody
<p>The POR antibody is a monoclonal antibody that targets the growth factor POR (Peroxidase). This antibody is used for immobilization studies and can be activated by chemical agents. It specifically binds to the cation channel and glycoprotein POR, allowing for easy detection and analysis. The POR antibody has been extensively tested in Life Sciences research and has shown high specificity and sensitivity. It can be used in various applications such as Western blotting, ELISA, immunohistochemistry, and flow cytometry. Additionally, this monoclonal antibody has been proven effective in studying arginase and lipoprotein lipase. Trust the POR antibody for reliable results in your research experiments.</p>PCNA antibody
<p>The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.</p>phospho Kidins220 antibody
<p>phospho Kidins220 antibody was raised in rabbit using residues 907-923 [RQMQRTITRQMpS919FDLTK] of the human 220 kDa kidins220 protein as the immunogen.</p>Degré de pureté :Min. 95%
