Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Tau antibody
<p>The Tau antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It acts as a growth factor and is known for its ability to target multidrug resistance. This powerful antibody has been extensively studied and has shown promising results in various research areas.</p>Degré de pureté :Min. 95%Goat anti Mouse IgG (Fab'2) (PE)
<p>Goat anti-mouse IgG (Fab'2) (PE) was raised in goat using murine IgG F(c) fragment as the immunogen.</p>Degré de pureté :Min. 95%DIL2 antibody
<p>The DIL2 antibody is a human monoclonal antibody that belongs to the class of anti-connexin agents. It is used in the field of Life Sciences for various applications. The DIL2 antibody specifically targets and binds to nuclear glycoproteins, making it a valuable tool for studying cellular processes and protein interactions. This monoclonal antibody has been widely used in research to detect and visualize specific proteins of interest, such as c-myc or tyrosine phosphorylated proteins. The DIL2 antibody is available as both a monoclonal and polyclonal form, allowing researchers to choose the best option for their specific experimental needs. With its high specificity and affinity, the DIL2 antibody is an essential tool for any researcher working in the field of molecular biology or immunology.</p>BCL2L1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCL2L1 antibody, catalog no. 20R-1065</p>Degré de pureté :Min. 95%SHB Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SHB antibody, catalog no. 70R-5789</p>Degré de pureté :Min. 95%Cotinine-HRP
<p>Cotinine-HRP is a monoclonal antibody that has neutralizing properties. It is commonly used in research laboratories to detect and measure the levels of various proteins and antigens in biological samples, particularly in human serum. This antibody is highly specific and can effectively bind to growth factors, such as erythropoietin, as well as antibodies, collagen, cardiomyocytes, alpha-fetoprotein, angiotensin-converting enzyme, chemokines, and inhibitors. Cotinine-HRP is often used in immunoassays and diagnostic tests to accurately quantify the presence of these substances. Its high sensitivity and reliability make it a valuable tool for researchers and scientists working in the field of protein analysis.</p>Degré de pureté :Min. 95%Chlamydia antibody
<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>Cefuroxime Axetil d-3 iso
<p>Cefuroxime Axetil d-3 iso (USP grade powder) chemical reference substance</p>Degré de pureté :Min. 95%MTHFR antibody
<p>The MTHFR antibody is a powerful tool used in various immunoassays and research applications. It specifically targets the methylenetetrahydrofolate reductase (MTHFR) enzyme, which plays a crucial role in dopamine metabolism and cytochrome P450 oxidoreductase activity. This monoclonal antibody is derived from a hybridoma cell line and exhibits high specificity and affinity for MTHFR.</p>LANCL2 antibody
<p>LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK</p>Degré de pureté :Min. 95%CDCA5 antibody
<p>CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP</p>KCNH5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH5 antibody, catalog no. 70R-1523</p>Degré de pureté :Min. 95%NTRK3 antibody
<p>NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG</p>Degré de pureté :Min. 95%SDF4 antibody
<p>SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA</p>AKAP7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP7 antibody, catalog no. 70R-3082</p>Degré de pureté :Min. 95%BBS5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BBS5 antibody, catalog no. 70R-9214</p>Degré de pureté :Min. 95%CD160 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD160 antibody, catalog no. 70R-5801</p>Degré de pureté :Min. 95%IFN λ 2 protein (Mouse)
<p>Region of IFN Lambda 2 protein corresponding to amino acids MDPVPRATRL PVEAKDCHIA QFKSLSPKEL QAFKKAKDAI EKRLLEKDMR CSSHLISRAW DLKQLQVQER PKALQAEVAL TLKVWENMTD SALATILGQP LHTLSHIHSQ LQTCTQLQAT AEPKPPSRRL SRWLHRLQEA QSKETPGCLE DSVTSNLFRL LTRDLKCVAS GDQCV.</p>Degré de pureté :Min. 95%LOC285033 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC285033 antibody, catalog no. 70R-3302</p>Degré de pureté :Min. 95%RANK Receptor antibody
<p>RANK receptor antibody was raised in rabbit using highly pure recombinant human sRANK Receptor as the immunogen.</p>Degré de pureté :Min. 95%EGF protein
<p>MNSDSECPLS HDGYCLHDGV CMYIEALDKY ACNCVVGYIG ERCQYRDLKW WELR</p>Degré de pureté :Min. 95%HIST1H1T Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H1T antibody, catalog no. 70R-2113</p>Degré de pureté :Min. 95%HNMT Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNMT antibody, catalog no. 70R-9830</p>Degré de pureté :Min. 95%CD8a antibody
<p>CD8a antibody was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.</p>Cystathionase Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTH antibody, catalog no. 70R-1253</p>Degré de pureté :Min. 95%CD38 antibody (Azide Free)
<p>CD38 antibody (Azide free) was raised in rat using CD38 as the immunogen.</p>PNMT antibody
<p>The PNMT antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It is a highly specific and sensitive tool for detecting AFP levels in various clinical settings. This antibody can be used in research, diagnostic, and therapeutic applications related to AFP, such as cancer detection and monitoring. Additionally, the PNMT antibody has been shown to have neutralizing effects on certain factors involved in adipose tissue function, such as transferrin, adiponectin, and TGF-beta. This makes it a valuable tool for studying adipocyte biology and potential therapeutic interventions for conditions related to adipose tissue dysfunction. Furthermore, the PNMT antibody has been found to interact with adp-ribosyl cyclase and collagen, suggesting its potential role in modulating cellular processes involving these molecules.</p>Myc antibody
<p>The Myc antibody is a highly versatile and potent tool in the field of life sciences. It is an antibody that specifically targets and binds to the Myc protein, which plays a crucial role in various cellular processes such as cell growth, proliferation, and differentiation. The Myc antibody can be used for a wide range of applications including immunohistochemistry, western blotting, flow cytometry, and immunoprecipitation.</p>Degré de pureté :Min. 95%ABCF2 antibody
<p>ABCF2 antibody was raised in mouse using recombinant Human Atp-Binding Cassette, Sub-Family F (Gcn20), Member 2 (Abcf2), Nuclear Gene Encoding Mitochondrial Protein</p>C17ORF82 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf82 antibody, catalog no. 70R-4283</p>Degré de pureté :Min. 95%GFAP antibody
<p>The GFAP antibody is a highly specific monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). This protein is predominantly expressed in astrocytes, and it plays a crucial role in maintaining the structure and function of these cells. The GFAP antibody can be used for various applications in life sciences research, including immunohistochemistry, western blotting, and flow cytometry.</p>SNAP23 protein
<p>1-211 amino acids: MDNLSSEEIQ QRAHQITDES LESTRRILGL AIESQDAGIK TITMLDEQKE QLNRIEEGLD QINKDMRETE KTLTELNKCC GLCVCPCNRT KNFESGKAYK TTWGDGGENS PCNVVSKQPG PVTNGQLQQP TTGAASGGYI KRITNDARED EMEENLTQVG SILGNLKDMA LNIGNEIDAQ NPQIKRITDK ADTNRDRIDI ANARAKKLID S</p>Degré de pureté :Min. 95%Dhrs3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Dhrs3 antibody, catalog no. 70R-8654</p>Degré de pureté :Min. 95%WBSCR1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WBSCR1 antibody, catalog no. 70R-1353</p>Degré de pureté :Min. 95%ZMAT3 antibody
<p>ZMAT3 antibody was raised in rabbit using the N terminal of ZMAT3 as the immunogen</p>Degré de pureté :Min. 95%LRRC23 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC23 antibody, catalog no. 70R-4072</p>Degré de pureté :Min. 95%VWF antibody (HRP)
<p>VWF antibody (HRP) was raised in goat using human vWF purified from plasma as the immunogen.</p>CDK2 antibody
<p>The CDK2 antibody is a high-specificity neutralizing antibody that targets a glycoprotein involved in cell cycle regulation. It has been shown to have low density and high specific activity, making it an ideal tool for research in the field of Life Sciences. This monoclonal antibody inhibits the activity of CDK2, a key enzyme involved in cell division and proliferation. By binding to CDK2, the antibody prevents its interaction with other proteins and interferes with the normal progression of the cell cycle. In addition to its role in cell cycle regulation, this antibody has also been found to have inhibitory effects on fatty acid metabolism and can modulate the production of superoxide and interferon. With its high specificity and potent neutralizing activity, the CDK2 antibody is an essential tool for researchers studying various biological processes and developing potential therapeutic interventions.</p>SIGLEC9 antibody
<p>The SIGLEC9 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to SIGLEC9, a transmembrane protein involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications. One of the key characteristics of the SIGLEC9 antibody is its ability to modulate immune responses. It has been shown to activate immune cells, such as natural killer (NK) cells and macrophages, leading to enhanced anti-tumor activity. Additionally, this antibody can induce interferon-stimulated gene expression, which plays a crucial role in antiviral defense mechanisms. Moreover, the SIGLEC9 antibody has shown promise as a diagnostic tool. It can be used as a serum marker for certain diseases and conditions, including autoimmune disorders and cancer. By detecting the presence or absence of SIGLEC9 autoantibodies in patient samples, healthcare professionals can gain valuable insights into disease progression and treatment response. Furthermore,</p>
