Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Minute Virus of Mice protein
<p>Purified native Minute Virus of Mice protein (Mouse)</p>Degré de pureté :Min. 95%ZNF322A antibody
<p>ZNF322A antibody was raised in rabbit using the C terminal of ZNF322A as the immunogen</p>Degré de pureté :Min. 95%Dnak protein
<p>A lid covering the substrate 508-638 amino acids: MNEDEIQKMV RDAEANAEAD RKFEELVQTR NQGDHLLHST RKQVEEAGDK LPADDKTAIE SALTALETAL KGEDKAAIEA KMQELAQVSQ KLMEIAQQQH AQQQTAGADA SANNAKDDDV VDAEFEEVKD KK</p>Degré de pureté :Min. 95%COMMD6 protein (His tag)
<p>Purified recombinant COMMD6 protein (His tag)</p>Degré de pureté :Min. 95%p53 antibody
<p>The p53 antibody is an extracellular antigen that specifically targets the p53 protein. This antibody is widely used in research and diagnostics to detect and quantify the presence of p53 in various samples. It can be used in immunohistochemistry, Western blotting, and ELISA assays. The p53 antibody is available as both polyclonal antibodies and monoclonal antibodies, offering researchers a range of options for their experiments. Additionally, this antibody can be used to study the role of p53 in different cellular processes, including apoptosis, cell cycle regulation, and DNA repair. With its high specificity and sensitivity, the p53 antibody is an essential tool for scientists working in life sciences and related fields.</p>CD10 antibody
<p>The CD10 antibody is a monoclonal antibody that is used in Life Sciences research. It is commonly used as an inhibitor and immobilized to study the function and expression of CD10, also known as neprilysin. CD10 is a glycoprotein that plays a crucial role in various biological processes, including cell migration, chemokine regulation, and antigen processing.</p>TMEM158 antibody
<p>TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR</p>Degré de pureté :Min. 95%TRKB antibody
<p>The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.</p>SLC22A15 antibody
<p>SLC22A15 antibody was raised using the middle region of SLC22A15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK</p>Degré de pureté :Min. 95%IL9 antibody
<p>IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT</p>Degré de pureté :Min. 95%ZCCHC12 protein (His tag)
<p>Purified recombinant ZCCHC12 protein (His tag)</p>Degré de pureté :Min. 95%GAPDH antibody
<p>GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC</p>ANXA11 antibody
<p>The ANXA11 antibody is a monoclonal antibody that specifically targets vitronectin, a protein involved in cell adhesion and migration. It has been widely used in life sciences research to study the interaction between vitronectin and various growth factors, chemokines, and other molecules. This antibody can be used for applications such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence of vitronectin in different tissues or cell types. Additionally, the ANXA11 antibody has shown promising results in targeting antigens like epidermal growth factor (EGF), anti-mesothelin antibodies, glucagon, and cetuximab. Its specificity and high affinity make it a valuable tool for researchers in the field of molecular biology and cellular signaling.</p>IRF3 antibody
<p>IRF3 antibody was raised in mouse using recombinant human IRF-3(108-166aa) purified from E. coli as the immunogen.</p>MUC3B antibody
<p>MUC3B antibody was raised using the middle region of MUC3B corresponding to a region with amino acids KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA</p>Degré de pureté :Min. 95%TRAPPC4 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>LETMD1 antibody
<p>LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED</p>Degré de pureté :Min. 95%TAPBP antibody
<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS</p>Degré de pureté :Min. 95%PRKCG antibody
<p>PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG</p>Degré de pureté :Min. 95%DPPA2 antibody
<p>DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL</p>OXSM antibody
<p>OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP</p>Gm13178 antibody
<p>Gm13178 antibody was raised in rabbit using the C terminal of Gm13178 as the immunogen</p>Degré de pureté :Min. 95%CD45 antibody
<p>CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.</p>Lidocaine antibody
<p>Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.</p>17b Trenbolone-HRP
<p>17b-Trenbolone 17 Conjugate for use in immunoassays</p>Degré de pureté :Min. 95%PHF10 antibody
<p>PHF10 antibody was raised using the middle region of PHF10 corresponding to a region with amino acids PELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDS</p>Il33 protein
<p>The Il33 protein is a versatile and essential component in the field of Life Sciences. It plays a crucial role in various biological processes, including cell growth, differentiation, and immune response regulation. This protein has garnered significant attention due to its potential therapeutic applications.</p>Degré de pureté :Min. 95%Rat Thymocyte antibody
<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.</p>Degré de pureté :Min. 95%SP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SP1 antibody, catalog no. 70R-4097</p>Degré de pureté :Min. 95%ADH4 antibody
<p>ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV</p>CD45RA antibody
<p>The CD45RA antibody is a monoclonal antibody that targets the CD45RA protein, which is expressed on certain immune cells. It has been shown to be effective in inhibiting the growth of Corynebacterium glutamicum, a bacterium commonly used in the production of amino acids. The CD45RA antibody can also block the activity of enzymes involved in collagen degradation, leading to potential applications in the field of regenerative medicine and tissue engineering. Additionally, this antibody has been used in Life Sciences research to study various cellular processes, including substrate sirna delivery, modulation of β-catenin signaling, and phosphorylcholine metabolism. Its versatility makes it a valuable tool for scientists studying immune responses, growth factors, sugar phosphotransferase activity, and even certain pathogens like Helicobacter pylori.</p>Insulin antibody
<p>Insulin antibody is a highly specialized antibody that plays a crucial role in regulating glucose metabolism. It is cytotoxic and can neutralize the effects of insulin by binding to it. This antibody has been widely used in research and clinical settings to study various aspects of insulin function.</p>AKTIP antibody
<p>AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA</p>FTCD antibody
<p>FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK</p>RARB antibody
<p>The RARB antibody is a monoclonal antibody that has various characteristics and applications in the field of Life Sciences. This antibody specifically targets the retinoic acid receptor beta (RARB), which is involved in numerous cellular processes. It has been shown to modulate the activity of cation channels, myostatin, natriuretic factors, fibrinogen, elastase protein, and lipoprotein lipase.</p>
