Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Vaspin antibody
<p>Vaspin antibody was raised in mouse using recombinant human Vaspin (21-414aa) purified from E. coli as the immunogen.</p>VPS4A antibody
<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN</p>Nuclear Pore Complex antibody
<p>The Nuclear Pore Complex antibody is a highly specific monoclonal antibody designed for use in Life Sciences research. It is used to detect and study the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. This antibody binds specifically to proteins within the nuclear pore complex, allowing researchers to visualize and study its function.</p>YARS antibody
<p>YARS antibody was raised in mouse using recombinant Tyrosyl-Trna Synthetase (Yars)</p>TSH β protein
<p>TSH beta protein is a native protein that belongs to the group of proteins and antigens. It is commonly used in life sciences research, particularly in studies related to colony-stimulating factors. TSH beta protein has been shown to have various functions, including the regulation of metabolism and growth. It can interact with other molecules such as flavobacterium, glucagon, monoclonal antibodies, and inhibitors. Additionally, TSH beta protein has been found to play a role in adipose tissue function and the production of growth factors like GM-CSF (granulocyte-macrophage colony-stimulating factor). Researchers often utilize TSH beta protein in experiments involving electrodes and anti-MERTK antibodies due to its unique properties and interactions.</p>Degré de pureté :≥98% By Sds-PageTSTA3 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.</p>PAFAH1B3 antibody
<p>PAFAH1B3 antibody was raised using the middle region of PAFAH1B3 corresponding to a region with amino acids GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN</p>Degré de pureté :Min. 95%PUS10 antibody
<p>PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN</p>CD2 antibody
<p>The CD2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It interacts with CD2, a cell surface glycoprotein expressed on T cells, natural killer cells, and thymocytes. This antibody has been extensively studied for its potential applications in various areas of research.</p>C11ORF65 antibody
<p>C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI</p>PLDN antibody
<p>PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE</p>Tau antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains, leading to cell growth inhibition in culture.</p>SLC39A5 antibody
<p>SLC39A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS</p>Degré de pureté :Min. 95%INSR antibody
<p>INSR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%ALDH3A1 antibody
<p>The ALDH3A1 antibody is a powerful tool in the field of antiviral research. It belongs to the class of Monoclonal Antibodies, which are highly specific and effective in targeting specific antigens. This antibody has been extensively studied for its ability to neutralize autoantibodies and antibodies that can cause autoimmune diseases. It has also shown promising results in combination with gemcitabine treatment, enhancing the effectiveness of this chemotherapy drug.</p>HAL antibody
<p>HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET</p>FT-1518
CAS :<p>FT-1518 is a potent anticancer inhibitor that targets protein kinases involved in cell cycle regulation and apoptosis. It is an analog of Chinese medicinal compounds that have been used for centuries to treat cancer. FT-1518 has been shown to selectively inhibit the growth of tumor cells, both in vitro and in vivo, while sparing normal cells. This compound has demonstrated significant activity against a range of human cancers, including breast, lung, colon, prostate, and ovarian cancer. FT-1518 inhibits the activity of specific kinases involved in cancer cell proliferation and survival. It has also been found to induce apoptosis in cancer cells by activating caspase-mediated pathways. Moreover, FT-1518 is excreted primarily through urine and has minimal toxicity towards normal cells. Overall, FT-1518 represents a promising new class of kinase inhibitors with potential therapeutic applications for the treatment of various types of cancer.</p>Formule :C20H26N8ODegré de pureté :Min. 95%Masse moléculaire :394.5 g/molUSP33 antibody
<p>The USP33 antibody is a polyclonal antibody that is commonly used in life sciences research. It specifically targets the USP33 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying USP33 levels in different samples.</p>Nexinhib 20
CAS :<p>Nexinhib 20 is a pro-inflammatory cytokine inhibitor that inhibits the production of pro-inflammatory cytokines, such as IL-1β and TNFα. It has been shown to be effective in reducing the growth of primary tumor cells and also reduces inflammation in diseases such as cancer, inflammatory bowel disease (IBD), and bowel diseases. Nexinhib 20 is not absorbed well when ingested orally due to its low bioavailability. It is also an acidic protein with a pI of 4.8.</p>Formule :C15H16N4O3Degré de pureté :Min. 95%Masse moléculaire :300.31 g/molTLE1 antibody
<p>TLE1 antibody was raised in rabbit using the N terminal of TLE1 as the immunogen</p>Degré de pureté :Min. 95%Zidovudine
<p>Zidovudine (USP grade powder) chemical reference substance</p>Degré de pureté :Min. 95%PARL antibody
<p>PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ</p>Degré de pureté :Min. 95%MCL1 antibody
<p>The MCL1 antibody is a highly specialized monoclonal antibody that targets the phosphatase growth factor. It has been specifically designed to neutralize tyrosine and colloidal substances in the body, making it an effective tool for various medical applications. This antibody has shown promising results in inhibiting the activity of glial fibrillary acidic proteins, which are associated with neurodegenerative diseases. Additionally, it has demonstrated its efficacy in targeting and neutralizing the circumsporozoite protein, making it a potential candidate for the development of vaccines against certain infectious diseases. The MCL1 antibody is a valuable asset in the field of medical research and holds great promise for future therapeutic interventions.</p>Sox2 antibody
<p>Sox2 antibody was raised in rabbit using residues 113-127 [KEHPDYKYRPRRKTK] of the 37 kDa human Sox2 protein as the immunogen.</p>Degré de pureté :Min. 95%H pylori, cagA protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Degré de pureté :Min. 95%COX10 antibody
<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL</p>Degré de pureté :Min. 95%FGF1 antibody
<p>The FGF1 antibody is a monoclonal antibody that specifically targets the HER2 protein. It belongs to the class of anti-HER2 antibodies, which also includes adalimumab and trastuzumab. This antibody binds to HER2, preventing its interaction with other biomolecules and inhibiting downstream signaling pathways involved in cell growth and division.</p>Vimentin antibody
<p>The Vimentin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and detect vimentin, an intermediate filament protein that plays a crucial role in maintaining cell structure and integrity. This antibody is particularly useful in research related to amyloid plaque formation, as it can identify activated vimentin in these structures.</p>ALDH1L1 antibody
<p>The ALDH1L1 antibody is a highly reactive collagen-specific antibody that is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and bind to the activated form of collagen, which is a key component of various biological processes. It can be used for applications such as immobilization and detection of collagen in samples, as well as for studying the role of collagen in different cellular pathways.</p>
