Produits biochimiques et réactifs

<p>Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.</p>

<p>Purified Polyclonal PMCA2 antibody</p>

<p>DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Purified Polyclonal GUCY1B2 antibody</p>

<p>The PAR4 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Protease-Activated Receptor 4 (PAR4) in various biological processes. PAR4 plays a crucial role in cellular signaling pathways, particularly those involving epidermal growth factors and growth factors. By binding to PAR4, this antibody effectively inhibits its activation by proteases, preventing downstream effects such as the release of inflammatory cytokines and interferons.</p>

<p>CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA</p>

<p>Rabbit polyclonal HIST1H4E antibody</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The MEKK2 antibody is an immunomodulatory substance that targets a specific phosphorylation site on collagen. It is designed to recognize and bind to this site, leading to the modulation of immune responses. This antibody can be used in various applications, including research studies, vaccine development, and the production of therapeutic antibodies.</p>

<p>FRAX1036 is a new molecule which inhibits the cancer-promoting activity of epidermal growth factor (EGF). FRAX1036 was shown to block the signaling pathways downstream of EGFR, including MAPK and β-catenin. This drug also synergistically inhibited tumor growth in mice with xenografts of human prostate cancer cells. FRAX1036 has been shown to be effective when combined with taxane treatment, which is an anticancer drug that inhibits the cell division cycle by blocking microtubule assembly.</p>

<p>Rabbit polyclonal CBCP6 antibody</p>

<p>Rabbit polyclonal GOLGA2 antibody</p>

<p>KLHL4 antibody was raised in rabbit using the N terminal of KLHL4 as the immunogen</p>

<p>The ANXA3 antibody is a growth factor that is widely used in the Life Sciences industry. It is a colloidal solution that contains histidine, which helps stabilize the antibody and maintain its potency. This antibody can be used in various applications, such as electrode coatings, cyclic peptide synthesis, and as a tool for studying protein-protein interactions.</p>

<p>Mouse monoclonal AURKC antibody</p>

<p>SMC1A antibody was raised in rabbit using the C terminal of SMC1A as the immunogen</p>

<p>Rabbit polyclonal TRKB antibody (Tyr515)</p>

<p>HBsAg is the surface antigenof the Hepatitis-B-Virus (HBV). The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins.</p>

<p>B3GALT6 antibody was raised using the C terminal of B3GALT6 corresponding to a region with amino acids VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE</p>

<p>The Ubiquitin antibody is a highly specific monoclonal antibody that targets the ubiquitin molecule. It is widely used in life sciences research for various applications, including immunoassays and the detection of target molecules. This antibody has been shown to have a high affinity for ubiquitin and can effectively detect its presence in samples.</p>

<p>Mouse monoclonal TUBAL3 antibody</p>

<p>The TP53 antibody is a highly specific monoclonal antibody that targets the TP53 protein. This protein plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody has been extensively studied and validated for its high affinity and specificity towards TP53.</p>

<p>Rabbit polyclonal SESN2 antibody</p>

<p>Akt, also called Protein Kinase B (PKB), is a serine/threonine-specific protein kinase crucial for regulating cellular functions such as growth, survival, metabolism, and proliferation. It serves as a central component in the PI3K/Akt/mTOR pathway, integrating signals required for cellular adaptation and function. Humans express three primary isoforms of Akt—Akt1, Akt2, and Akt3—each encoded by different genes. Activation of Akt starts when external signals, like growth factors or insulin, bind to cell surface receptors, which then activate phosphoinositide 3-kinase (PI3K). This cascade leads to the formation of PIP3 on the cell membrane, recruiting Akt to undergo two key phosphorylation events at Thr308 and Ser473. Once activated, Akt can travel within the cell to phosphorylate target proteins.The main functions of Akt include enhancing cell survival by blocking apoptosis through the inactivation of pro-apoptotic proteins such as BAD and Caspase-9, and promoting cell growth and proliferation by activating mTOR, a critical regulator of protein synthesis. Akt also plays a central role in metabolism, boosting glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, which is especially important in muscle and fat tissues. Additionally, Akt facilitates angiogenesis by upregulating VEGF, supporting tissue repair, and enhances cell migration, assisting in wound healing but also enabling the spread of cancer cells. Given its broad role in supporting cell growth and survival, Akt is frequently hyperactivated in cancers, fueling unchecked cell division and tumor development, which makes it a target in cancer treatments. Furthermore, Akt’s role in glucose metabolism connects it to insulin signaling, where pathway disruptions can lead to impaired glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>Mouse monoclonal VAMP1/2 antibody</p>

<p>TRPA1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal TUBAL3 antibody</p>

<p>The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The RALA antibody is a highly specific monoclonal antibody that is used in Life Sciences research for ultrasensitive detection. It is designed to bind to the receptor binding site of alpha-fetoprotein, a growth factor that is often associated with various diseases and conditions. The RALA antibody has been proven to be effective in detecting alpha-fetoprotein in human serum samples, making it a valuable tool for diagnostic purposes. Additionally, this antibody can also be used for the detection of amyloid plaque, which is a hallmark of certain neurodegenerative diseases. With its high affinity and specificity, the RALA antibody enables researchers to accurately identify and study these biomarkers, contributing to advancements in disease diagnosis and treatment.</p>

<p>Mouse monoclonal ILVBL antibody</p>

<p>Mouse monoclonal TCF11 antibody</p>

<p>ST6GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL</p>

<p>Turkey RBC antibody was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal NFkB p100 antibody (Ser872)</p>

<p>The CD90.2 antibody is a highly sensitive fluorescent probe that is used for ultrasensitive detection in various applications. It is a monoclonal antibody that specifically targets the CD90.2 antigen, which is a cell surface marker found on various cell types, including immune cells and stem cells. This antibody can be used in research and diagnostic settings to detect the presence of CD90.2 in samples such as human serum or tissue sections.</p>

<p>The SHIP antibody is a highly specialized monoclonal antibody that exhibits cytotoxic properties. It specifically targets elastase, an enzyme involved in various inflammatory processes. By neutralizing elastase activity, the SHIP antibody helps regulate immune responses and reduces tissue damage caused by excessive inflammation. Additionally, this antibody has been found to inhibit the production of autoantibodies, which are antibodies that mistakenly target healthy cells and tissues. This makes it a promising therapeutic option for autoimmune disorders. The SHIP antibody also interacts with lectins, insulin, fibronectin, collagen, and other molecules involved in cell signaling pathways. Its unique binding properties make it a valuable tool for researchers in the field of Life Sciences, as well as for diagnostic purposes in human serum analysis. Furthermore, recent studies have shown that the SHIP antibody has anti-VEGF (vascular endothelial growth factor) activity, making it a potential candidate for anti-angiogenic therapies. In summary, the SHIP antibody offers a wide range</p>

<p>EIF4ENIF1 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (Eif4Enif1)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAD2 antibody, catalog no. 70R-4921</p>

<p>VIPR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively tested using advanced techniques like the patch-clamp technique on human erythrocytes, confirming its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, ensuring effective utilization within the body. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains and inhibit cell growth, this drug is a valuable weapon against tuberculosis.</p>

<p>WNT2B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH</p>

<p>Rabbit polyclonal SFXN3 antibody</p>

<p>Mouse monoclonal SH2D2A antibody</p>

<p>SLC13A3 antibody was raised in rabbit using the C terminal of SLC13A3 as the immunogen</p>

<p>Rabbit polyclonal SEC63 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The p47 phox antibody is a highly specialized glycoprotein that plays a crucial role in various cellular processes. This antibody specifically targets the epidermal growth factor and is widely used in research and diagnostic applications. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their specific needs.</p>