Produits biochimiques et réactifs

<p>Rabbit polyclonal ADRA1A antibody</p>

<p>BCAT1 antibody was raised in Rabbit using Human BCAT1 as the immunogen</p>

<p>The CD15 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor CD15. It has been extensively studied for its potential therapeutic applications in various fields, including autoantibodies, interferon, and growth factor research. This antibody has shown great promise in neutralizing the effects of CD15, thereby inhibiting the activity of this chemokine receptor.</p>

<p>CAPG antibody was raised in Rabbit using Human CAPG as the immunogen</p>

<p>HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV</p>

<p>ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen</p>

<p>FAM120A antibody was raised using the middle region of FAM120A corresponding to a region with amino acids SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAE</p>

<p>The Nod2 antibody is a highly specialized monoclonal antibody that binds to the Nod2 receptor. This receptor is involved in various cellular processes and plays a crucial role in immune responses. The Nod2 antibody has been extensively studied and proven to have high affinity and specificity for its target.</p>

<p>Rabbit polyclonal LAMB2 antibody</p>

<p>The DHPS antibody is a highly specific monoclonal antibody that targets the epidermal growth factor receptor (EGFR) pathway. It plays a crucial role in regulating cell growth, proliferation, and survival. This antibody has been extensively studied in Life Sciences research and has proven to be an invaluable tool for studying various cellular processes.</p>

<p>Rabbit polyclonal SYN1 antibody (Ser605)</p>

<p>BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS</p>

<p>Rabbit polyclonal TIN2 antibody</p>

<p>Purified lactoferrin from human milk.</p>

<p>The HAT antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to collagen, a protein found in connective tissues. The HAT antibody can be used in various applications, including immunoassays and cytotoxicity studies. It has been shown to have neutralizing properties against trypsin-like protease, which plays a role in tissue lysis. Additionally, the HAT antibody has been found to inhibit reactive oxygen species production and lipid peroxidation, making it useful for studying oxidative stress-related processes. With its high specificity and affinity for collagen, this antibody is a valuable tool for researchers working in the field of cell biology and molecular biology.</p>

<p>CDR2L antibody was raised in rabbit using the C terminal of CDR2L as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4E antibody, catalog no. 70R-4682</p>

<p>Mouse monoclonal CD11c antibody (allophycocyanin)</p>

<p>LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL</p>

<p>The USP7 antibody is a monoclonal antibody that targets the USP7 protein. It has been shown to have a wide range of applications in the field of Life Sciences. This antibody specifically binds to USP7 and inhibits its activity, which plays a crucial role in various cellular processes including IFN-gamma signaling, fatty acid metabolism, siderophore production, and superoxide regulation.</p>

<p>ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW</p>

<p>1-318 amino acids: MGSSHHHHHH SSGLVPRGSH MPNIKIFSGS SHQDLSQKIA DRLGLELGKV VTKKFSNQET CVEIGESVRG EDVYIVQSGC GEINDNLMEL LIMINACKIA SASRVTAVIP CFPYARQDKK DKSRAPISAK LVANMLSVAG ADHIITMDLH ASQIQGFFDI PVDNLYAEPA VLKWIRENIS EWRNCTIVSP DAGGAKRVTS IADRLNVDFA LIHKERKKAN EVDRMVLVGD VKDRVAILVD DMADTCGTIC HAADKLLSAG ATRVYAILTH GIFSGPAISR INNACFEAVV VTNTIPQEDK MKHCSKIQVI DISMILAEAI RRTHNGESVS YLFSHVPL</p>

<p>Plasmin protein is a pegylated, neutralizing growth factor that plays a crucial role in various Life Sciences applications. It is commonly used in the field of Proteins and Antigens for its ability to promote the growth and differentiation of mesenchymal stem cells. Additionally, plasmin protein has been found to have intraocular effects and can be used in the development of antibodies, including monoclonal antibodies.</p>

<p>ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen</p>

<p>Purified recombinant SNURF protein (His tag)</p>

<p>Rabbit polyclonal SAP18 antibody</p>

<p>The SFTPB Antibody is an activated antibody that serves as a serum marker for various medical conditions. It specifically targets cardiomyocytes and can be used to detect the presence of autoantibodies in the blood. This antibody has also been utilized in the field of regenerative medicine, particularly in studies involving pluripotent stem cells. The SFTPB Antibody is a glycoprotein that interacts with specific receptors on cell membranes, resulting in the activation of transmembrane conductance and facilitating the transmission of signals such as acetylcholine or other active agents. This versatile antibody is widely used in Life Sciences research and has proven to be an invaluable tool in understanding various physiological processes. The SFTPB Antibody is available as Polyclonal Antibodies, ensuring high specificity and sensitivity for accurate detection and analysis.</p>

<p>Mouse monoclonal ATG3 antibody</p>

<p>Ractopamine 10 Conjugate for use in immunoassays</p>

<p>The TRIM2 antibody is a highly specialized monoclonal antibody that targets insulin and has neutralizing properties. It specifically binds to cholinergic receptors, inhibiting their activity and preventing the release of insulin. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HS3ST1 antibody, catalog no. 70R-5492</p>

<p>ZBTB3 antibody was raised in rabbit using the middle region of ZBTB3 as the immunogen</p>

<p>Chloroquine N-oxide is an analog of Chloroquine that acts as a potent kinase inhibitor. It has been shown to have anticancer properties and can induce apoptosis in cancer cells. Chloroquine N-oxide has been found to be effective against a variety of human tumors, including lung, breast, and colon cancers. This drug inhibits the activity of hepcidin, a protein involved in iron metabolism, which may contribute to its anticancer effects. Additionally, Chloroquine N-oxide has been detected in the urine of Chinese patients with cancer who were treated with this drug. This suggests that it may have potential as an anticancer agent for humans.</p>

<p>Rabbit polyclonal Breast Tumor Kinase antibody</p>

<p>The BRS3 antibody is a polyclonal antibody that serves as an affinity ligand for extracellular substances. It is commonly used in the field of medicine to isolate retinal autoantibodies. The BRS3 antibody has been found to be effective in inhibiting DNA double-strand break repair and can be used as a tool for studying the mechanisms involved in this process. In addition, it has been shown to inhibit the growth of pluripotent stem cells and can be used in research related to their differentiation. The BRS3 antibody is often employed in immunohistochemical studies to detect the presence of certain markers or proteins in tissue samples. Its use in life sciences research has provided valuable insights into various biological processes and pathways.</p>

<p>Purified recombinant HMGN3 protein (His tag)</p>

<p>UBE2L6 antibody was raised in mouse using recombinant human UBE2L6 (1-152aa) purified from E. coli as the immunogen.</p>

<p>IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL</p>

<p>Prealbumin protein is a biochemical substance that is used for the treatment and/or prophylaxis of certain conditions. It can be quantitated using monoclonal antibodies specific to prealbumin protein. This protein contains histidine residues, which can serve as inhibitors of certain enzymes. Monoclonal antibody-based assays are commonly used in Life Sciences research to study the expression and function of prealbumin protein. Prealbumin protein is also known as transthyretin, a carrier protein for thyroid hormones and retinol-binding proteins. Native Proteins &amp; Antigens, including prealbumin protein, are widely used in various research applications such as Western blotting, ELISA, and immunohistochemistry. Additionally, prealbumin protein has been implicated in anti-angiogenesis processes and may be targeted by autoantibodies in certain autoimmune diseases.</p>

<p>The STAT5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes tyrosinase, an enzyme involved in melanin production. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The STAT5 antibody has been extensively validated and has shown excellent specificity and sensitivity in detecting tyrosinase expression. It can be used to study melanoma progression, evaluate the efficacy of anti-tyrosinase therapies, and explore the role of tyrosinase in other biological processes. Whether you are a researcher or a pharmaceutical company working on developing new treatments for skin disorders, the STAT5 antibody is an essential tool for your studies.</p>

<p>Rat monoclonal Toll-like receptor 9 antibody (FITC)</p>

<p>Mouse monoclonal Cytokeratin 19 antibody (Prediluted for IHC)</p>

<p>BUD31 antibody was raised in Rabbit using Human BUD31 as the immunogen</p>

<p>PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP</p>

<p>KIFAP3 antibody was raised in Rabbit using Human KIFAP3 as the immunogen</p>

<p>BTAF1 antibody was raised in mouse using recombinant Btaf1 Rna Polymerase Ii, B-Tfiid Transcription Factor-Associated, 170Kda (Mot1 Homolog, S. Cerevisiae) (Btaf1)</p>

<p>LTF antibody was raised in Rabbit using Human LTF as the immunogen</p>

<p>Purified recombinant KCTD4 protein (His tag)</p>

<p>The CD74 protein is a collagen-based peptide agent that has been pegylated for enhanced stability and efficacy. It acts as an inhibitor of various biological processes and has shown promising results in the field of Life Sciences. The CD74 protein has been found to neutralize influenza hemagglutinin, inhibit the activity of angiotensin-converting enzyme, and modulate the levels of growth factors and chemokines in human serum. Additionally, it has demonstrated the ability to bind to alpha-fetoprotein and erythropoietin receptors, suggesting potential applications in cancer treatment and blood disorders. With its unique properties and monoclonal antibody structure, the CD74 protein holds great promise for further research and therapeutic development.</p>

<p>The Caveolin 1 antibody is a highly effective and versatile tool used in various fields of life sciences. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their specific needs.</p>