Produits biochimiques et réactifs

<p>Rabbit polyclonal RCBTB2 antibody</p>

<p>Rabbit polyclonal GRIN2B antibody (N-terminus)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXNDC13 antibody, catalog no. 70R-7432</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFC1 antibody, catalog no. 70R-2507</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Thra antibody, catalog no. 70R-8055</p>

<p>Rabbit Polyclonal PKC theta antibody (Ser695)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9A antibody, catalog no. 70R-8642</p>

<p>ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN</p>

<p>SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEV</p>

<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>

<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>

<p>The SOX11 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is designed to target and bind to specific proteins, such as globulin, in order to inhibit their activity. This antibody has been extensively studied and proven effective in various applications.</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody (Ser337)</p>

<p>Rabbit polyclonal HLA-DOA antibody</p>

<p>Rabbit polyclonal SLPI antibody (biotin)</p>

<p>VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIM1 antibody, catalog no. 70R-2101</p>

<p>Rabbit polyclonal Osteopontin antibody (biotin)</p>

<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>

<p>IRF8 antibody was raised in rabbit using the C terminal of IRF8 as the immunogen</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>

<p>Purified Polyclonal DHRS7 antibody</p>

<p>ST3GAL3 antibody was raised using the N terminal of ST3GAL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK</p>

<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>

<p>CER1 antibody was raised in Mouse using a purified recombinant fragment of human CER1 expressed in E. coli as the immunogen.</p>

<p>Cell penetrating peptides (CPP) are a keen area of molecule design to create the ideal vector for transporting macromolecule cargo into the cell. There is also a crossover of CPP acting as antimicrobial peptides (AMP) due to their ability to permeabilise the lipid membrane. AMPs are now being considered as a tool against the rise of antibiotic-resistant bacteria. CPPs and AMPS tend to be 10 - 30 amino acids long, cationic, and rich in arginine and tryptophan. The RWR motif has been used to generate de novo CPP/AMP peptides with improved functions. Of these, RWmix was shown to have the highest cellular uptake against other RWR synthetics, the lowest cytotoxicity and significant antimicrobial activity.RWmix is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-RWmix allows a wide variety of applications particularly for conjugation, modification, and peptide design.</p>

<p>Affinity purified Rabbit polyclonal NDUFA5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SHROOM2 antibody, catalog no. 70R-5079</p>

<p>IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI</p>

<p>ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL</p>

<p>Purified Polyclonal LIMK1/2 antibody</p>

<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-5890</p>

<p>CTBP1 antibody was raised in Rabbit using Human CTBP1 as the immunogen</p>

<p>Recombinant human RBBP9 protein (His tag)</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DENND1B antibody, catalog no. 70R-7093</p>

<p>Rabbit polyclonal CAF1B antibody</p>

<p>Goat anti Bird IgG (H + L) secondary antibody</p>

<p>PTK6 antibody was raised using the middle region of PTK6 corresponding to a region with amino acids SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL</p>

<p>Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS</p>

<p>Purified Rabbit polyclonal IKK gamma antibody</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Purified Polyclonal Plexin A2 antibody</p>

<p>FRK antibody was raised using the middle region of FRK corresponding to a region with amino acids DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPG</p>

<p>EDC4 antibody was raised using the N terminal of EDC4 corresponding to a region with amino acids LQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C7orf16 antibody, catalog no. 70R-9151</p>

<p>ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS</p>

<p>Purified Polyclonal MKK1/2 antibody</p>

<p>Purified recombinant RCHY1 protein (His tag)</p>