Produits biochimiques et réactifs

<p>Rabbit polyclonal GPBAR antibody</p>

<p>Rabbit polyclonal PTTG1IP antibody</p>

<p>Mouse monoclonal CD90.1 antibody (PE)</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>PARP6 antibody was raised in rabbit using the N terminal of PARP6 as the immunogen</p>

<p>ALDH1A1 antibody was raised in Mouse using a purified recombinant fragment of human ALDH1A1 expressed in E. coli as the immunogen.</p>

<p>Purified recombinant RPL35A protein (His tag)</p>

<p>The Methcathinone antibody is a highly effective neutralizing agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target autoantibodies. This antibody has shown remarkable efficacy in inhibiting the activity of acidic molecules such as β-catenin and TGF-beta1 (also known as TGF-β1). Additionally, it has been proven effective in blocking the action of trastuzumab, fibronectin, collagen, and alpha-fetoprotein. The Methcathinone antibody is widely recognized for its exceptional binding affinity and specificity towards TGF-beta, making it an invaluable tool in protein research and therapeutic applications.</p>

<p>Salmeterol Conjugate for use in immunoassays</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>MESP1 antibody was raised in rabbit using the N terminal of MESP1 as the immunogen</p>

<p>LGI1 antibody was raised in Rabbit using Human LGI1 as the immunogen</p>

<p>FAM84A antibody was raised using the N terminal of FAM84A corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD</p>

<p>Rat monoclonal LPAM1 antibody (allophycocyanin)</p>

<p>The PKR antibody is a monoclonal antibody that targets the protein kinase R (PKR), an enzyme involved in cellular responses to stress and viral infection. This antibody specifically binds to PKR, preventing its activation and inhibiting its downstream signaling pathways. The PKR antibody has been widely used in Life Sciences research, particularly in studies related to epidermal growth factor (EGF) signaling and cancer biology. It has also been used as a family kinase inhibitor in various experimental settings. The PKR antibody can be utilized for applications such as Western blotting, immunoprecipitation, and immunofluorescence. With its high specificity and affinity, this antibody is a valuable tool for researchers studying the role of PKR in cellular processes and disease development.</p>

<p>The PLK1 antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It specifically targets and binds to the PLK1 protein, which is primarily found in the nucleus of cells. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting PLK1 expression levels.</p>

<p>ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI</p>

<p>Rabbit polyclonal Transferrin antibody (FITC)</p>

<p>SB 258719 is a selective 5-HT1A receptor antagonist, which is a type of pharmacological agent that binds to and inhibits the activity of the 5-HT1A receptor. It is synthesized from chemical compounds typically used in neurobiological research. The mode of action involves the competitive blockade of serotonin (5-HT) at the 5-HT1A receptor sites, thereby preventing serotonin from activating these receptors in the brain.</p>

<p>Purified Polyclonal FSBP antibody</p>

<p>HAV VP3 antibody is a monoclonal antibody that specifically targets the HAV VP3 protein. It is commonly used in life sciences research to study the role of this protein in various biological processes. This antibody has been shown to bind to actin filaments, nuclear proteins, and albumin, making it a versatile tool for studying protein interactions and localization. Additionally, HAV VP3 antibody has been used in studies involving atypical hemolytic uremic syndrome and Brucella abortus infection. With its high specificity and affinity, this monoclonal antibody is a valuable asset for researchers in the field of immunology and molecular biology.</p>

<p>Purified recombinant p15 Treponema pallidum protein</p>

<p>Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS</p>

<p>PTPN2 antibody was raised using the middle region of PTPN2 corresponding to a region with amino acids ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN</p>

<p>The RIPK2 antibody is a highly specialized monoclonal antibody that targets the protein complex involved in various cellular processes, including growth factor signaling and transferrin metabolism. This antibody specifically recognizes RIPK2, a nuclear receptor that plays a crucial role in the regulation of biomolecules such as mineralocorticoid receptors. The RIPK2 antibody can be used for research purposes to study the function and localization of RIPK2 in different cell types.</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>

<p>gAcrp30 antibody was raised in goat using highly pure recombinant human gAcrp30/adipolean as the immunogen.</p>

<p>Mouse monoclonal TNF beta antibody (allophycocyanin)</p>

<p>Purified Rabbit polyclonal ERF antibody</p>

<p>Mouse monoclonal GKAP antibody</p>

<p>The CREB antibody is a highly specialized monoclonal antibody that is designed to target and bind to the CREB protein. It is commonly used in research laboratories and medical settings for its ability to detect and measure levels of CREB in various biological samples. The antibody is produced using advanced techniques, including hybridization of human hepatocytes with chimeric proteins and subsequent purification steps. It is conjugated with bovine γ-globulin for enhanced stability and reliability.</p>

<p>The hnRNP A1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets hnRNP A1, a protein involved in various cellular processes including RNA metabolism and splicing. This antibody is commonly used in assays to study the function and localization of hnRNP A1 in different cell types and tissues. Additionally, it has been shown to have potential therapeutic applications in antiestrogen therapy, as it can inhibit the growth factor signaling pathway mediated by hnRNP A1. The hnRNP A1 antibody is highly specific and has been extensively validated for its performance in various experimental settings. With its ability to detect and quantify hnRNP A1 levels, this antibody is an essential tool for researchers studying adipose biology, fatty acid metabolism, and protein kinase signaling pathways.</p>

<p>Rabbit polyclonal SAR1A antibody</p>

<p>MIER1 antibody was raised in Rabbit using Human MIER1 as the immunogen</p>

<p>The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD4L antibody, catalog no. 70R-2633</p>

<p>The BAG2 antibody is a highly specialized monoclonal antibody that targets specific antigens in the field of Life Sciences. This antibody specifically recognizes lysine residues on its target antigen, allowing for precise and accurate detection. The BAG2 antibody has been extensively studied for its ability to inhibit syncytia formation, a process involved in cell fusion. Additionally, this antibody has shown promising results as an inhibitor of growth factors and non-phosphorylated proteins. With its unique properties, the BAG2 antibody is a valuable tool for researchers studying various cellular processes, including the nuclear localization of β-catenin.</p>

<p>Serotonin receptor 3C antibody was raised using a synthetic peptide corresponding to a region with amino acids CCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKT</p>

<p>Rat monoclonal CD122 antibody (biotin)</p>

<p>SETBP1 antibody was raised in rabbit using the middle region of SETBP1 as the immunogen</p>

<p>CXCR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Rotavirus SA11 protein is a native protein that plays a crucial role in the antigen-antibody reaction. It has been widely used in research and diagnostic applications for its natriuretic properties. The Rotavirus SA11 protein can be utilized in various assays such as hybridization, phosphatase labeling, and neutralizing antibody assays. Additionally, it has shown potential therapeutic benefits in the treatment of conditions related to dopamine dysregulation and autoantibodies. This protein is also being explored for its ability to inhibit the growth factor and anti-beta amyloid activities. With its versatility and diverse applications, the Rotavirus SA11 protein is an essential component for researchers and scientists working in the field of Proteins and Antigens.</p>

<p>Rabbit polyclonal SF3A1 antibody</p>

<p>BSA conjugated Sulfamethoxazole Hapten</p>

<p>HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL</p>

<p>The p38 MAPK antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the activity of p38 MAPK, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>The Perforin antibody is a monoclonal antibody that acts as an immunosuppressant in the field of Life Sciences. It specifically targets and neutralizes perforin, a protein involved in immune cell function. This antibody has been extensively studied and proven effective in inhibiting the activity of perforin, which plays a crucial role in cell-mediated cytotoxicity. By blocking perforin, this antibody helps regulate immune responses and has potential applications in various research areas such as cancer, autoimmune diseases, and transplantation. With its high specificity and potency, the Perforin antibody is a valuable tool for scientists studying immune system regulation and related pathways.</p>

<p>Rabbit polyclonal RPL30 antibody</p>