Produits biochimiques et réactifs

<p>Mouse monoclonal MTMR14 antibody</p>

<p>ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE</p>

<p>Rabbit polyclonal UBE2D4 antibody</p>

<p>Mouse monoclonal 200 kDa Neurofilament antibody</p>

<p>Cathepsin inhibitor</p>

<p>Mouse monoclonal NIT2 antibody</p>

<p>Mouse monoclonal CKMB antibody (MM subunit)</p>

<p>MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII</p>

<p>TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT</p>

<p>Synthetic human phosphopeptide (Ser645) region immunogen; rabbit polyclonal Rad17 antibody (Ser645)</p>

<p>Lamin B2 antibody was raised using the middle region of LMNB2 corresponding to a region with amino acids EVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM</p>

<p>IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 2 as the immunogen.</p>

<p>The CD123 antibody is a trifunctional genotoxic antibody that targets the tyrosine kinase receptor CD123. It belongs to the class of monoclonal antibodies and has been shown to have anti-beta amyloid properties. This antibody works by binding to CD123, which is expressed on the surface of certain cells, including cancer cells. Once bound, it activates protein kinase pathways and chemokine signaling, leading to cell death and inhibition of tumor growth. The CD123 antibody has also been found to modulate phosphatase activity and regulate the expression of growth factors such as alpha-fetoprotein. This antibody is widely used in the field of life sciences for research purposes and has shown promising results in preclinical studies.</p>

<p>Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET</p>

<p>SLC20A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL</p>

<p>CACYBP antibody was raised in Rabbit using Human CACYBP as the immunogen</p>

<p>Mouse anti- Furacilinum metabolite monoclonal antibody</p>

<p>Rabbit polyclonal SCO1 antibody</p>

<p>The anti-human CCR1 is a potent cytotoxic agent that targets the CCR1 receptor, a key molecule involved in various cellular processes. This monoclonal antibody specifically binds to the CCR1 receptor and inhibits its activation, leading to reduced collagen production and endothelial cell growth. The anti-human CCR1 antibody has been extensively studied in Life Sciences research and has shown significant efficacy in suppressing cell cytotoxicity. It is also effective against multidrug-resistant cells that overexpress the CCR1 receptor. Furthermore, this antibody can be used in combination with other therapeutic agents such as ethionamide to enhance their efficacy. The anti-human CCR1 antibody exhibits high specificity and affinity towards its target molecule, making it a valuable tool for researchers studying immune responses and inflammatory diseases. Additionally, this antibody has been used in hybridization studies to detect the presence of CCR1 mRNA and protein expression levels. Its ability to inhibit superoxide production further highlights its potential as an important tool in understanding</p>

<p>Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF</p>

<p>Rabbit polyclonal RAB11FIP2 antibody</p>

<p>Mouse monoclonal ACY3 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>

<p>gAcrp30 antibody was raised in goat using highly pure recombinant human gAcrp30/adipolean as the immunogen.</p>

<p>Mouse monoclonal TNF beta antibody (allophycocyanin)</p>

<p>Purified Rabbit polyclonal ERF antibody</p>

<p>Mouse monoclonal GKAP antibody</p>

<p>The CREB antibody is a highly specialized monoclonal antibody that is designed to target and bind to the CREB protein. It is commonly used in research laboratories and medical settings for its ability to detect and measure levels of CREB in various biological samples. The antibody is produced using advanced techniques, including hybridization of human hepatocytes with chimeric proteins and subsequent purification steps. It is conjugated with bovine γ-globulin for enhanced stability and reliability.</p>

<p>The hnRNP A1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets hnRNP A1, a protein involved in various cellular processes including RNA metabolism and splicing. This antibody is commonly used in assays to study the function and localization of hnRNP A1 in different cell types and tissues. Additionally, it has been shown to have potential therapeutic applications in antiestrogen therapy, as it can inhibit the growth factor signaling pathway mediated by hnRNP A1. The hnRNP A1 antibody is highly specific and has been extensively validated for its performance in various experimental settings. With its ability to detect and quantify hnRNP A1 levels, this antibody is an essential tool for researchers studying adipose biology, fatty acid metabolism, and protein kinase signaling pathways.</p>

<p>Rabbit polyclonal SAR1A antibody</p>

<p>MIER1 antibody was raised in Rabbit using Human MIER1 as the immunogen</p>

<p>The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD4L antibody, catalog no. 70R-2633</p>

<p>The BAG2 antibody is a highly specialized monoclonal antibody that targets specific antigens in the field of Life Sciences. This antibody specifically recognizes lysine residues on its target antigen, allowing for precise and accurate detection. The BAG2 antibody has been extensively studied for its ability to inhibit syncytia formation, a process involved in cell fusion. Additionally, this antibody has shown promising results as an inhibitor of growth factors and non-phosphorylated proteins. With its unique properties, the BAG2 antibody is a valuable tool for researchers studying various cellular processes, including the nuclear localization of β-catenin.</p>

<p>Serotonin receptor 3C antibody was raised using a synthetic peptide corresponding to a region with amino acids CCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKT</p>

<p>Rat monoclonal CD122 antibody (biotin)</p>

<p>SETBP1 antibody was raised in rabbit using the middle region of SETBP1 as the immunogen</p>

<p>CXCR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Rotavirus SA11 protein is a native protein that plays a crucial role in the antigen-antibody reaction. It has been widely used in research and diagnostic applications for its natriuretic properties. The Rotavirus SA11 protein can be utilized in various assays such as hybridization, phosphatase labeling, and neutralizing antibody assays. Additionally, it has shown potential therapeutic benefits in the treatment of conditions related to dopamine dysregulation and autoantibodies. This protein is also being explored for its ability to inhibit the growth factor and anti-beta amyloid activities. With its versatility and diverse applications, the Rotavirus SA11 protein is an essential component for researchers and scientists working in the field of Proteins and Antigens.</p>

<p>Rabbit polyclonal SF3A1 antibody</p>

<p>BSA conjugated Sulfamethoxazole Hapten</p>

<p>HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL</p>

<p>The p38 MAPK antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the activity of p38 MAPK, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>The Perforin antibody is a monoclonal antibody that acts as an immunosuppressant in the field of Life Sciences. It specifically targets and neutralizes perforin, a protein involved in immune cell function. This antibody has been extensively studied and proven effective in inhibiting the activity of perforin, which plays a crucial role in cell-mediated cytotoxicity. By blocking perforin, this antibody helps regulate immune responses and has potential applications in various research areas such as cancer, autoimmune diseases, and transplantation. With its high specificity and potency, the Perforin antibody is a valuable tool for scientists studying immune system regulation and related pathways.</p>

<p>Rabbit polyclonal RPL30 antibody</p>

<p>JAKMIP2 antibody was raised in Rabbit using Human JAKMIP2 as the immunogen</p>

<p>SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL</p>