Produits biochimiques et réactifs

<p>The CD51 antibody is a powerful tool for researchers in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to CD51, a protein found on mesenchymal stem cells. This antibody has various applications, including as a cytokine inhibitor and growth factor binding agent.</p>

<p>COPZ1 antibody was raised in Rabbit using Human COPZ1 as the immunogen</p>

<p>Rabbit polyclonal YARS antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAU1 antibody, catalog no. 70R-5010</p>

<p>Rabbit polyclonal CDKL2 antibody</p>

<p>STAT3 antibody was raised in mouse using recombinant Signal Transducer And Activator Of Transcription 3 (Acute-Phase Response Factor)</p>

<p>The PARP antibody is a monoclonal antibody that belongs to the class of antibodies used in Life Sciences. It specifically targets and binds to poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair processes. This antibody has been shown to be effective in neutralizing PARP activity, making it a valuable tool for studying the role of PARP in various cellular processes.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thus inhibiting transcription and replication, which ultimately stops bacterial growth. Extensive research has been conducted on human erythrocytes using a patch-clamp technique to demonstrate its high efficacy. Additionally, this medication undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it binds specifically to markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAF1B antibody, catalog no. 70R-1602</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Auh antibody, catalog no. 70R-8476</p>

<p>Rabbit polyclonal VPRBP antibody</p>

<p>The ANGPT1 protein is a multidrug that plays a crucial role in various biological processes. It is involved in collagen synthesis, regulation of blood vessel development, and maintenance of vascular integrity. ANGPT1 can be found in human serum and has been extensively studied for its therapeutic potential.</p>

<p>Rabbit polyclonal LEG9 antibody</p>

<p>Rabbit polyclonal SLC7A4 antibody</p>

<p>Rabbit polyclonal HLA-DOB antibody</p>

<p>Purified Polyclonal INPP5E antibody</p>

<p>JWH-018 Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of N6AMT1 antibody, catalog no. 70R-3428</p>

<p>ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL</p>

<p>H2AFY antibody was raised using the N terminal of H2AFY corresponding to a region with amino acids HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV</p>

<p>Purified Rabbit polyclonal MYB23 antibody</p>

<p>EHD2 antibody was raised in Rabbit using Human EHD2 as the immunogen</p>

<p>Rabbit polyclonal TAS2R39 antibody</p>

<p>Purified Polyclonal BAIAP2L1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf33 antibody, catalog no. 70R-4032</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Antp antibody, catalog no. 70R-2190</p>

<p>Inhibitor of extracellular signal-regulated kinases ERK1 and ERK2</p>

<p>Inhibits dishevelled (Dvl)-PDZ domain interaction; affects Wnt signaling pathway</p>

<p>Psi-7977-13C-d3 is a stable isotope-labeled compound, a modified version of sofosbuvir, which is a well-known nucleotide analog. It is synthesized to incorporate carbon-13 and deuterium, making it useful for pharmacokinetic studies. The isotopic labeling allows researchers to trace the metabolic pathways and disposition of the drug in biological systems with high precision.</p>

<p>PGPC is a chemical compound that has been shown to have antioxidant properties and inhibit skin cancer cells. It has been shown to be effective in a model system for tissue culture, where it inhibited the growth of human monoclonal antibody-producing cells. PGPC has also been shown to have immunosuppressive effects and inhibit the activation of toll-like receptor 4 by bacterial lipopolysaccharides. PGPC has also been shown to have anti-inflammatory effects in autoimmune diseases and cell lysis in myocardial infarcts, atherosclerotic lesions, and other inflammatory diseases.<br>PGPC may be used as an adjuvant therapy for the treatment of skin cancer, tissue culture, or autoimmune diseases.</p>

<p>The EGR1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the early growth response protein 1 (EGR1), which plays a crucial role in various cellular processes such as growth, differentiation, and apoptosis. This antibody has been extensively validated for its specificity and sensitivity in detecting EGR1 expression in different tissues and cell types.</p>

<p>Insulin-like growth factor II (IGF2) is a peptide that belongs to the insulin-like growth factors family. It has been shown to activate ion channels and receptors, which are important for cell signaling. IGF2 is also an inhibitor of protein interactions that are involved in signal transduction pathways, such as receptor-ligand interactions and protein-protein interactions. This peptide can be used as a research tool or an antibody.</p>

<p>Stylopine hydrochloride is an isoquinoline alkaloid, which is a naturally occurring compound primarily extracted from plants in the Papaveraceae family, such as Papaver and Corydalis species. Its mode of action involves the inhibition of certain enzymes and modulation of calcium channels, which are critical in the regulation of various biochemical pathways.</p>

<p>HRP Conjugated Rabbit anti-HA Antibody</p>

<p>Product Citations:</p>

<p>anti-Calmodulin Binding Peptide Antibody</p>

<p>anti-DYKDDDDK Antibody</p>

<p>Purified recombinant PSMD13 protein (His tag)</p>

<p>HRP Conjugated Rabbit anti-S-Tag Antibody</p>

<p>anti-Calmodulin Binding Peptide Antibody</p>

<p>Purified Rabbit polyclonal DYNLL2 antibody</p>

<p>HRP Conjugated Rabbit anti-VSV-g Tag Antibody</p>

<p>HRP Conjugated Chicken anti-HA Antibody</p>

<p>FITC Conjugated Rabbit anti-HA Antibody</p>

<p>HRP Conjugated Rabbit anti-T7 Antibody</p>

<p>Please enquire for more information about anti-C-Myc Antibody (FITC) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HRP Conjugated Chicken anti-Protein A (staphylococcal) Antibody</p>

<p>This biotin conjugated rabbit anti-6xHIS tag antibody allows for specific detection of His-tagged fusion proteins. Please inquire for bulk pricing.</p>

<p>HRP Conjugated Rabbit anti-GST Tag Antibody</p>

<p>Please enquire for more information about anti-C-Myc Antibody (HRP) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>