Produits biochimiques et réactifs

<p>Purified recombinant RPS10 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRYBA4 antibody, catalog no. 70R-9136</p>

<p>MGFWEEFESL QKQEVKNLHQ RLEGQRPENK GKNRYKNILP FDHSRVILQG RDSNIPGSDY INANYIKNQL LGPDENAKTY IASQGCLEAT VNDFWQMAWQ ENSRVIVMTT REVEKGRNKC VPYWPEVGMQ RAYGPYSVTN CGEHDTTEYK LRTLQVSPLD NGDLIREIWH YQYLSWPDHG VPSEPGGVLS FLDQINQRQE SLPHAGPIIV HCSAGIGRTG TIIVIDMLME NISTKGLDCD IDIQKTIQMV RAQRSGMVQT EAQYKFIYVA IAQFIETTKK KLEVLQSQKG QESEYGNITY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIRREL antibody, catalog no. 70R-6888</p>

<p>The MGMT antibody is a growth factor that belongs to the group of polyclonal antibodies. It is used in life sciences research as a tool for studying various cellular processes. This antibody specifically targets and binds to MGMT, a protein involved in DNA repair and cell survival. By neutralizing the activity of MGMT, the antibody can inhibit its function and potentially impact cellular processes such as DNA damage response and apoptosis. The MGMT antibody can be used in experiments to investigate the role of MGMT in different cell types or disease models. It is available both as polyclonal antibodies and monoclonal antibodies, providing researchers with options based on their specific experimental needs. Whether studying adipose tissue biology or investigating cytotoxic mechanisms, this antibody is an essential tool for researchers in the field of life sciences.</p>

<p>The RGMB antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for various research applications. This antibody is specifically designed to neutralize the activity of RGMB, a glycopeptide that plays a crucial role in intraocular development.</p>

<p>BEST3 antibody was raised in rabbit using the C terminal of BEST3 as the immunogen</p>

<p>RG9MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRN</p>

<p>CPT1C antibody was raised in Rabbit using Human CPT1C as the immunogen</p>

<p>The SNAP25 antibody is a highly effective tool in the field of Life Sciences. As a monoclonal antibody, it has the ability to specifically target and neutralize SNAP25, a protein involved in neurotransmitter release. This antibody can be used in various research applications, such as immunoassays, immunohistochemistry, and Western blotting.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD4A antibody, catalog no. 70R-4176</p>

<p>Affinity purified Rabbit polyclonal Sec61 gamma subunit antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Affinity purified Rabbit polyclonal EPH receptor A8 antibody</p>

<p>Rabbit polyclonal RIN3 antibody</p>

<p>SLC39A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG</p>

<p>GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL</p>

<p>Purified recombinant CHAC2 protein (His tag)</p>

<p>Mouse monoclonal STAT4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH22 antibody, catalog no. 70R-1834</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RG9MTD3 antibody, catalog no. 70R-4974</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SGK3 antibody, catalog no. 70R-5846</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53I13 antibody, catalog no. 70R-9111</p>

<p>Goat anti-monkey IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using monkey IgG, IgA, IgM whole molecules as the immunogen.</p>

<p>The ADRA2C antibody is a polyclonal antibody that specifically targets the ADRA2C receptor. This receptor is involved in various physiological processes, including the regulation of blood pressure, neurotransmitter release, and vasoconstriction. The ADRA2C antibody can be used in life sciences research to study the role of this receptor in different cellular pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INTS4 antibody, catalog no. 70R-9105</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4G antibody, catalog no. 70R-1917</p>

<p>The CCR6 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the CCR6 protein, which plays a crucial role in various biological processes. The CCR6 antibody can be used for research purposes such as studying the activation of growth factors and tyrosine kinase receptors. It has also been shown to have cytotoxic effects, making it a potential candidate for antibody-drug conjugates.</p>

<p>FEM1B antibody was raised in Rabbit using Human FEM1B as the immunogen</p>

<p>Rabbit polyclonal OR4C13 antibody</p>

<p>alpha 1 Antiplasmin antibody was raised in goat using human alpha 1 Antiplasmin purified from plasma as the immunogen.</p>

<p>C1ORF174 antibody was raised using the middle region of C1Orf174 corresponding to a region with amino acids EAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLSVPKHSAGSGAEESNSS</p>

<p>Luteinizing hormone beta antibody was raised in mouse using human luteinizing hormone as the immunogen.</p>

<p>KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK</p>

<p>TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PKN2 antibody, catalog no. 70R-10386</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC17 antibody, catalog no. 70R-1832</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NTSR1 antibody, catalog no. 70R-6966</p>

<p>The Phospholamban antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize phospholamban, an inhibitory factor involved in the regulation of calcium uptake and release in cardiac muscle cells. This antibody has been extensively tested and shown to effectively lyse phospholamban-expressing cells, making it a valuable tool for researchers studying the role of phospholamban in various physiological processes. Additionally, this antibody has also been found to have neutralizing effects on certain autoantibodies, such as antiphospholipid antibodies, and can modulate the activity of colony-stimulating factors like GM-CSF. With its high specificity and potency, the Phospholamban antibody is an essential component for any research project involving phospholamban or related proteins.</p>

<p>Affinity purified Rabbit polyclonal Inhibin beta A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DBI antibody, catalog no. 70R-2557</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FGFBP2 antibody, catalog no. 70R-10120</p>

<p>Purified Polyclonal KCNK15 antibody</p>

<p>Rabbit polyclonal OR6C68 antibody</p>

<p>Rabbit polyclonal Spermidine synthase antibody (FITC)</p>

<p>The Norovirus G2 antibody is a monoclonal antibody used in life sciences research. It specifically targets the G2 strain of the norovirus, which is a common cause of gastroenteritis. This antibody can be used to detect and study the protein expression of norovirus in various samples, including nuclear extracts, lysozyme, alpha-fetoprotein, and glycopeptides. The monoclonal antibody recognizes specific glycosylation patterns on the norovirus protein, allowing for accurate detection and analysis. It has also been used in studies related to androgen signaling in human serum and arginase activity. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying norovirus and its impact on human health.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf201 antibody, catalog no. 70R-4814</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM129A antibody, catalog no. 70R-1294</p>

<p>Recombinant Human IFN-gamma</p>

<p>Rabbit polyclonal LKB1 antibody (Thr189)</p>