Produits biochimiques et réactifs

<p>The KRT23 antibody is a monoclonal antibody that specifically targets and binds to Keratin 23 (KRT23), a protein involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.</p>

<p>Rabbit polyclonal ICB-1 antibody</p>

<p>Rabbit polyclonal TIGD5 antibody</p>

<p>Mouse monoclonal LMCD1 antibody</p>

<p>Rat monoclonal TIM3 antibody (PE)</p>

<p>Rabbit polyclonal WFS1 antibody</p>

<p>C20ORF10 antibody was raised using the middle region of C20Orf10 corresponding to a region with amino acids TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN</p>

<p>BRD7 antibody was raised in rabbit using the C terminal of BRD7 as the immunogen</p>

<p>RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA</p>

<p>1-270 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMLS AHWEKKKTSL VELQEQLQQL PALIADLESM TANLTHLEAS FEEVENNLLH LEDLCGQCEL ERCKHMQSQQ LENYKKNKRK ELETFKAELD AEHAQKVLEM EHTQQMKLKE RQKFFEEAFQ QDMEQYLSTG YLQIAERREP IGSMSSMEVN VDMLEQMDLM DISDQEALDV FLNSGGEENT VLSPALGPES STCQNEITLQ VPNPSELRAK PPSSSSTCTD SATRDISEGG ESPVVQSDEE EVQVDTALAT SHTDREATPD GGEDSDS</p>

<p>Zeranol Conjugate for use in immunoassays</p>

<p>LAMA4 antibody was raised in Rabbit using Human LAMA4 as the immunogen</p>

<p>Purified recombinant Lin28B protein (His tag)</p>

<p>Hantavirus (Seoul) antibody was raised in mouse using Nucleocapsid protein of Hantavirus R22 strain as the immunogen.</p>

<p>BTG1 antibody was raised in mouse using recombinant Human B-Cell Translocation Gene 1, Anti-Proliferative (Btg1)</p>

<p>Rabbit polyclonal XRCC6 antibody</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>CMV antibody was raised in mouse using glycoprotein gH as the immunogen.</p>

<p>TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL</p>

<p>Purified Polyclonal Cadherin 8 antibody</p>

<p>Purified recombinant rpmD protein (His tag)</p>

<p>Rabbit polyclonal ZDHHC5 antibody</p>

<p>VEGF antibody was raised in rabbit using highly pure recombinant rat VEGF as the immunogen.</p>

<p>Rabbit polyclonal TCEA3 antibody</p>

<p>Mouse monoclonal DPP10 antibody</p>

<p>RNASEH2A antibody was raised using the C terminal of RNASEH2A corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES</p>

<p>HGS antibody is a functional sweetener that acts as an adalimumab growth factor. It is commonly used in immunoassays to detect and quantify specific proteins. HGS antibody specifically targets the ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco), an enzyme involved in carbon fixation during photosynthesis. By binding to Rubisco, HGS antibody inhibits its activity, leading to a decrease in carbon dioxide fixation and ultimately impacting plant growth. This monoclonal antibody is highly specific and has been widely used in life sciences research to study the role of Rubisco and its autoantibodies. Additionally, HGS antibody can be used as a tool for the development of polyclonal antibodies targeting specific molecules of interest. Its versatility and high specificity make it an essential component in various research applications within the field of Life Sciences.</p>

<p>The MAP2 antibody is a polyclonal antibody that specifically targets the protein MAP2. This protein plays a crucial role in various cellular processes, including neuronal development and maintenance. The MAP2 antibody has been extensively studied in the field of life sciences and has shown great potential for research purposes.</p>

<p>Purified recombinant RPL5 protein (His tag)</p>

<p>Rabbit polyclonal SENP7 antibody</p>

<p>ZNF641 antibody was raised in rabbit using the middle region of ZNF641 as the immunogen</p>

<p>The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.</p>

<p>GMEB1 antibody was raised in rabbit using the N terminal of GMEB1 as the immunogen</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>Rabbit polyclonal ERP29 antibody (FITC)</p>

<p>KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>CD8 antibody (FITC) was raised in mouse using human CD8 as the immunogen.</p>

<p>BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Perilipin antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) S M N K G P T L L D G D L P E Q(17) C of rat Perilipin A and B, as the immunogen.</p>

<p>Rat monoclonal CD23 antibody (FITC)</p>

<p>The ANXA1 antibody is a life sciences product that belongs to the category of extracellular antibodies. It is a medicament substance that interacts with calcium ions and targets annexin A1, a protein involved in various cellular processes. This antibody can be used for research purposes, such as isolating nucleic acids or studying the function of carbohydrates and peptides. The ANXA1 antibody specifically recognizes and binds to annexin A1, allowing for the detection and analysis of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody provides researchers with a valuable tool for studying the role of annexin A1 in different biological systems. Its amino acid sequence has been carefully designed to ensure optimal binding and performance in various experimental settings. Whether you're investigating signaling pathways or exploring new therapeutic targets, the ANXA1 antibody offers reliable results and contributes to advancing scientific knowledge in the field of life sciences.</p>

<p>The ACTA2 antibody is a highly specialized monoclonal antibody that targets actin filaments in human serum. It has been extensively tested and proven to be cytotoxic against a wide range of cells. This antibody works by binding to actin filaments, disrupting their structure and function, ultimately leading to cell death.</p>

<p>Hamster RBC antibody was raised in rabbit using hamster erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal RPL7 antibody</p>

<p>Rabbit polyclonal DAP1 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ETV3L antibody, catalog no. 70R-8690</p>

<p>Rabbit polyclonal Src antibody (Ser75)</p>

<p>The SYNGR4 antibody is a highly advanced nanocomposite medicament that has shown remarkable efficacy in various applications within the field of Life Sciences. This monoclonal antibody, which has been pegylated for enhanced stability and bioavailability, exhibits exceptional binding affinity towards collagen in human serum. Through its unique mechanism of action, the SYNGR4 antibody effectively targets and neutralizes specific markers, such as alpha-fetoprotein, adeno-associated antibodies, and actin antibodies.</p>